KEGG   Rattus norvegicus (rat): 291605Help
Entry
291605            CDS       T01003                                 

Gene name
Myot, Ttid
Definition
(RefSeq) myotilin
  KO
K19875  myotilin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    291605 (Myot)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    291605 (Myot)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    291605 (Myot)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     291605 (Myot)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set BiPBP_C C2-set_2 Ig_6 Transposase_22
Motif
Other DBs
NCBI-GeneID: 291605
NCBI-ProteinID: NP_001099618
RGD: 1310569
Ensembl: ENSRNOG00000047186
UniProt: D3ZTC5
Position
18p11
AA seq 496 aa AA seqDB search
MFNYERPKHFIQSQNPCGSGLQPPGPEVSSFPNQTKQSSIVIQPRQCTEQRFSASSTVSS
HITVSSSAYPASQQLAGPNPGQKVTATYNQSPASFLSSILPSQPDYSNSKIPSTVDSNYQ
QSSVHQPVNAVSSQAAGAKPTPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLTY
EEKMARRLLGPQNAAAVFQAQNSDVQDSSQHNPEHARLQVPTSQVRSRSSSRADANDQDA
IQEKFYPPRFIQVPENMSIEEGRFCRMDFKVSGLPAPDVSWYLNGRLVQSDELHKMIVSE
KGFHSLIFEVVRASDAGPYACVARNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVFE
GESVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYHDNAGRVTLLIKDVNKKDAGWYT
VSAVNEAGVTTCNTRLDVTARPNQTPPAPKQLRVRPTFSKYLALNGKGLDVKQAFNPEGE
FQRLAAQSGLYESEEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactacgaacgtccaaaacacttcatccagtcccaaaatccatgtggctccggg
ctgcagcctccaggacctgaagtctccagcttccctaaccagaccaaacagtcttccatc
gtcatccagcctcgccaatgcaccgagcagagattttctgcttcctccacagtgagctct
cacatcaccgtgtcttcctctgcttatcctgcttcccagcagctggctggccccaacccc
ggtcagaaggttactgctacctataaccagtccccagccagcttcctcagttctatatta
ccgtctcagcctgattacagtaacagtaaaatcccatccactgtggactccaactatcaa
caatcctcagttcaccaacctgtaaatgccgtgtcatcccaagctgcaggtgctaagccc
actccaaggactcctgaccacgaaatccaaggatcaaaagaagcattgattcaagatttg
gaaagaaagctgaaatgcaaagacacccttcttcataatggaaaccaaagactgacctat
gaggagaagatggctcgcaggttgttaggaccgcagaatgctgctgctgtgtttcaagct
caaaacagtgacgtccaagattcgtcacagcataacccagaacatgcacggctgcaagtt
cccacatcacaagtaagaagtagatcgtcctccagagcagacgcaaatgaccaggatgcc
atccaggagaagttttacccaccacgcttcattcaagtgccagaaaatatgtccatcgaa
gaaggaagattctgcagaatggactttaaagtgagtggactgccagcccctgatgtgtca
tggtatctaaacgggagactggtgcaatcagatgagttgcacaaaatgatagtgtcagag
aagggtttccactccctcatctttgaagtggtcagagcatcagatgcagggccatatgca
tgtgtagccagaaacagagctggagaagccaccttcacagtgcagctggatgttctggca
aaagagcacaaaagagcaccgatgtttatctacaaaccacagagcaaaaaggtttttgag
ggagaatcagtgaagttagagtgccagatctcagctatccctccaccaaagcttttctgg
aaaagaaacaacgaaatggttcagttcaacactgaccggataagcttatatcatgataat
gctggaagagtaactttactgataaaagatgtaaacaagaaggatgctgggtggtataca
gtgtcagcagtcaatgaagctggcgtgaccacgtgtaacacaagattagatgtcacagcc
cgtccaaaccaaactcccccagctcctaagcaactgcgtgttcgaccaactttcagcaaa
tatttagccctaaatgggaaaggtttggatgtgaaacaagctttcaaccctgaaggagag
tttcagcgtctggcagctcaatccggactctatgaaagtgaagaactttaa

DBGET integrated database retrieval system