KEGG   Rattus norvegicus (rat): 291609Help
Entry
291609            CDS       T01003                                 

Gene name
Ndfip1
Definition
(RefSeq) Nedd4 family interacting protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2370 Comm WBP-1
Motif
Other DBs
NCBI-GeneID: 291609
NCBI-ProteinID: NP_001013077
RGD: 1310053
Ensembl: ENSRNOG00000013562
UniProt: Q5U2S1
Position
18p11
AA seq 221 aa AA seqDB search
MALALAALAAVEPACGTGYQQLQNEEEPGEREQTAGDAPPPYSSISAESAAYFDYKDESG
FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML
TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL
WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctttggcgttggcggcgctggcggcggtggagccggcctgcggcactgggtaccag
cagttgcagaatgaagaggagcctggggagcgggaacagactgcgggtgacgcccctcca
ccctacagcagcatctctgcggagagtgcagcatattttgactacaaagatgaatctggg
tttccaaagcccccatcttataatgtggctacaacactgcccagctatgacgaggctgag
agaaccaaggctgaagccaccatccctttggttcctggaagagatgaagattttgtgggt
cgggatgattttgatgatgctgaccagctgaggataggaaacgatgggatttttatgtta
acctttttcatggcattcctcttcaactggattgggtttttcttgtctttttgcctgacc
acctcagctgcgggaaggtatggggccatctcaggatttggtctttctctaattaagtgg
atccttattgtcaggttttccacctatttccctggatactttgatggccagtactggctc
tggtgggtgttcttggttttaggctttctcctgtttctcagaggatttatcaattatgca
aaagttcggaagatgccagaaactttctcaaatctccccaggaccagagttctctttatt
tattaa

DBGET integrated database retrieval system