KEGG   Rattus norvegicus (rat): 291637Help
Entry
291637            CDS       T01003                                 

Gene name
Pcdhga5
Definition
(RefSeq) protocadherin gamma subfamily A, 5
  KO
K16495  protocadherin gamma subfamily A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    291637 (Pcdhga5)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Protocadherins
   291637 (Pcdhga5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2 Cadherin_3 RET_CLD1
Motif
Other DBs
NCBI-GeneID: 291637
NCBI-ProteinID: NP_001032214
RGD: 1311949
UniProt: I6LBX3
Position
18p11
AA seq 932 aa AA seqDB search
MADPPRRLICNDLLTFFMLLGTLCAPGNGQIRYSVREELDKGSFVGNISKDLGLEPRELA
ERGVRIISRGRSQLFSLNPRGGSLVTAGRIDREELCAQSAPCLISFNILVENKMKIYEVE
VEVLDINDNFPRFRDEELKVKVNENAAAGTRLVLPFARDGDVGVNSLQGYQLSANPHFSL
DVKSGSDGQKHPELVLEQPLDREKESALDLVLTALDGGNPVHSSTVHISVTVLDANDNAP
LFTQSEYRVNVPENTPVGTRLLILTATDADEGINAKLTFSFRNEEDKISETFQLDSNLGE
ISTIQSLDYEESSFYLMEVVAQDGGALLASAKVLVTVQDVNDNAPEVILTSLTSSVSEDC
LPGTIIALFSVHDADSGENGEVSCSIPKNLPFKLEKSVNNYYHLLTTSALDREETSDYNI
TVTVVDRGTPPLSTENHISLKVADINDNPPTFSRPSYSTSISENNPRGVSIFSVNAYDAD
SGDNARITYSLAEYTFQEVPVSSYVSINSDTGVLYALQSFDYEHLRDLQLLVTAKDSGNP
PLSSNASLSLFVLDQNDNTPEILYPAIPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQ
NAWLSYRLLKASEPGLFSIGLHTGEVCTARALLDRDVPKQSLVVAVQDHGQPPLSATVTL
TIAVGDSIPDVLTDLGNHNTPAEPQDSDLTLYLVVSVAVVSCVFLGFVTVLLALRLRHWH
MSRLLQTSTGRLASMPASHFVGMDGVQAYLQTYSHEISLTTDSKKSHLIFPQPNYADRLI
SEESCEKSEPLLIPDNIHTSKEEPGAAQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGTGTMGLSARYGPQFTLQHVPDYRQNVYIPGS
NATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccaccgaggcgcttgatctgcaacgacctgctgacgttcttcatgctgcta
gggacgctgtgcgcgccaggaaatgggcagatccgctactctgtgcgggaggagctagac
aaaggctccttcgtgggcaacatctccaaggacctggggctggagccccgcgagctggcg
gagcgcggggtccgcatcatctccagaggtaggtcgcagcttttctctctgaacccgcga
ggcggcagcctggtcaccgcaggaaggatagaccgggaggagctgtgcgctcagagcgcg
ccctgtctcatcagctttaacatcttggttgagaataaaatgaaaatttatgaagtagaa
gtagaagtccttgatattaatgataacttcccccggttccgcgatgaggagttaaaagta
aaggtaaatgaaaacgcagctgctggaacacgtttggtgctccccttcgcgagagatggg
gatgtgggtgtgaattccctccagggttaccagctcagcgccaacccgcacttctcactg
gacgtaaagagtggatctgacgggcaaaaacacccagagttggtgttggaacagcccctg
gaccgtgagaaggagtctgctctcgacctggtcctcacagctttggacggcggaaaccca
gtacattctagcactgtccatatcagcgtgaccgtcctcgacgcaaatgacaacgcaccc
ctgttcacgcaaagcgaatacagagtgaatgttccggaaaacacacctgtgggcactaga
ctcctcatactcaccgccacagatgcagacgagggaatcaatgcgaagttgaccttctct
ttccgcaacgaagaagataaaatttctgaaactttccaactcgattctaatctgggtgag
atctcaactattcaatccttggactatgaagaatccagtttctatctcatggaagtggta
gcccaggacggcggcgctcttcttgccagcgctaaggtgttggtcacagtccaggacgtg
aatgacaatgctccagaagtgatactcacctccctcaccagttccgtttccgaagactgt
ctacccggaaccataattgcacttttcagcgtacatgatgctgattccggggagaatgga
gaggtttcatgttctattcccaagaaccttcccttcaaactggaaaagtcagtaaataat
tactaccacctactaacaacaagcgcactggatagagaggagacttcggattataatatc
acagtgaccgtcgttgatcgcgggactcctcccctgtctacagaaaaccacatctctctg
aaagtagccgacataaatgacaacccacccaccttctctcgtccctcctattccacttcc
atctcagaaaataaccccagaggtgtctccattttttcggtaaatgcctatgatgctgac
agcggtgataatgcccggatcacttactccctggctgaatatacatttcaagaagtgccc
gtgtcctcctacgtctccattaactctgacactggagtcctgtatgcactacagtccttt
gactatgagcacttgagagacctgcagctcctggtgacagctaaggacagtgggaaccct
ccactcagtagcaatgcctccctgagcttgtttgtgctggaccagaatgacaacacgcct
gagatcctgtacccagctattcctactgatggctccacgggtgtggaactggcaccccgc
tctgcagagcctggatacctggtaaccaaagttgtggcagtggacaaagattcgggacag
aacgcctggttatcctaccgcctgctcaaggccagtgaaccagggctcttctcaataggg
cttcacacgggtgaggtgtgcacagcaagggctctattggatagagacgtacccaagcag
agcctggtagtggctgtccaggaccatggccagccccctctctcagccactgtcacactc
actatcgctgtaggggacagcatcccggatgtactgactgacttaggcaaccacaacaca
ccagcagagccccaggattcagacctcacactctacctagtggtatcggtggcagtggtc
tcctgtgtctttctgggatttgttaccgtgctgttggccctcaggctgaggcactggcac
atgtcacgcctgcttcagacttccacgggcagattggccagcatgcccgcctcccatttt
gtgggcatggatggggtacaggcttacctgcagacctattcccatgaaatctctctcact
acagactccaaaaaaagccacctgatcttcccccagcccaattatgctgacagactcatt
agtgaagagagctgtgaaaagagtgagcctcttctgatacctgataatatacacacaagc
aaggaagagcccggagctgctcagcaagccccgcccaacactgactggcgtttctctcaa
gcccagagacccggcacgagcggatcccaaaatggggatgaaaccggcacctggcccaac
aaccagttcgatacagagatgctgcaagccatgatcttggcctctgccagtgaagccgct
gatgggagctccactctgggagggggcactggcactatgggtttgagcgctcgatatgga
ccccagtttaccctgcagcacgtgcctgactaccgccagaacgtgtacatccctggcagc
aatgccacactgaccaacgcagctggcaaacgagatggcaaggctccggcaggcggcaat
ggcaacaagaagaagtcgggcaagaaagagaagaagtaa

DBGET integrated database retrieval system