KEGG   Rattus norvegicus (rat): 29165
Entry
29165             CDS       T01003                                 

Gene name
Gzmk
Definition
(RefSeq) granzyme K
  KO
K08663  granzyme K [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29165 (Gzmk)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     29165 (Gzmk)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   29165 (Gzmk)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 29165
NCBI-ProteinID: NP_058815
RGD: 68401
Ensembl: ENSRNOG00000010661
UniProt: P49864
Position
2q14
AA seq 258 aa
MSFSSSALVFLVAGIYMSSESFHTEIIGGREVQPHSRPFMASIQYRGKHICGGVLIHPQW
VLTAAHCYSRGHSPTVVLGAHSLSKNEPMKQTFEIKEFIPFSGFKSGTNDIMLIKLRTAA
ELNKHVQLLHLRSKNYIRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSY
YNHKPVITKDMICAGDRRGEKDSCKGDSGGPLICKGVFHALVSGGYKCGISNKPGVYTLL
TKKYQTWIKSKLAPSSAH
NT seq 777 nt   +upstreamnt  +downstreamnt
atgagcttttcttcatctgctctggttttccttgtggccgggatttatatgtcttcagag
agtttccatactgaaattattggagggagagaagtacagccacattccaggccttttatg
gcttccatccagtaccgcggcaagcatatttgtggaggagtcctgatccatccgcagtgg
gtgctaacagccgcccactgctactctcgaggccactctcccacggttgttttaggagca
cattctctttcaaagaatgagcccatgaaacagacatttgagattaaggaattcatcccg
ttctcaggatttaagtctggaacgaatgacatcatgctgataaagcttcgcacggctgca
gaactgaacaagcatgtccaactgcttcacctgagatccaaaaactatattagagatgga
actaaatgccaggttactggctggggatccaccaagccagatgtgttaaccacctctgat
acactgcaggaagtcactgttaccatcataagtagaaaacgctgcaacagccagagctac
tacaaccataaacctgttataaccaaggacatgatctgtgcaggggatcgcagaggcgaa
aaggattcctgcaagggtgactctggtggtcctttgatctgcaaaggtgtcttccatgcc
ctagtctctgggggctataaatgtggcatctccaacaagcctggagtctacaccctgttg
actaagaaatatcagacctggatcaaaagcaagcttgccccgtcgagtgcacattga

DBGET integrated database retrieval system