KEGG   Rattus norvegicus (rat): 29167Help
Entry
29167             CDS       T01003                                 

Gene name
Dctn1
Definition
(RefSeq) dynactin subunit 1
  KO
K04648  dynactin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    29167 (Dctn1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    29167 (Dctn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29167 (Dctn1)
   03036 Chromosome and associated proteins [BR:rno03036]
    29167 (Dctn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29167 (Dctn1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    29167 (Dctn1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     29167 (Dctn1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     29167 (Dctn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynactin CAP_GLY Lebercilin UPF0242
Motif
Other DBs
NCBI-GeneID: 29167
NCBI-ProteinID: NP_077044
RGD: 62038
Ensembl: ENSRNOG00000010048
UniProt: P28023
Structure
PDB: 

Position
4q34
AA seq 1280 aa AA seqDB search
MAQSKRHMYNRTPSGSRMSTEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKILKRE
GADAAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRDQVRDLEEKLETLRLKRSE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEAKEAKEALEAKERYMEEMADTA
DAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLK
QLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAES
TIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARET
ELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEAS
VERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGG
DHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLS
LLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLT
KAIKYYQHLYSIHLAEQPEESTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIA
LLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVL
QEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCSILISTMN
KLATAMQEGEYDAERPPSKPPPVEPWPAALRAEITDAEGLGLKLEDRETVIKELKKSLKI
KGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMDALQA
DIDQLEAEKTELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGGTPGQAPGAL
PGPGPVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKFSLPPHEG
PGGNLLSGALYRKTSQLLEKLNQLSTYTHVVDITRSSPACKSPSAQLMEQVAQLKSLSDT
IEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGLGQ
RHRLVLTQEQLHQLHGRLIS
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atggcccagagcaagaggcacatgtacaatcggacgcccagtggcagcaggatgagtacg
gaggcaagcgcccggcccctgcgggtcggctcccgtgtggaggtgattgggaagggccac
cgtggtactgtggcctatgttggagctacactctttgccactggcaagtgggtgggcgtg
atcctggatgaagcaaaaggcaagaacgatggtaccgttcagggaaggaagtatttcaca
tgcgatgaaggccacggcatctttgtacgccaatcccagatccaagtatttgaagatgga
gcagatactacttccccagagactcctgattcttctgcttcaaagatcctcaagagagag
ggagctgatgcagctgcaaagaccagcaaactgcggggactgaagcctaagaaggcaccg
acagcccgaaagaccacaactcgacggcccaagcctactcgcccagccagtactggggtg
gctgggcccagtagctccttgggcccctctggatcagcatcagccggtgaactgagcagc
agtgagcccagcaccccagctcagactccgctggcagcacccatcatccccacaccggcc
ctcacctctcctggagcagcacccccacttccttctccctctaaggaagaggaagggctg
agggaccaggtacgggacctggaggagaagctggagaccttgcgtctgaaacgctcagaa
gacaaagcaaagctgaaggagctggagaagcacaagatccagctggagcaggtgcaggaa
tggaagagcaaaatgcaggagcagcaggcggacctgcagcggcgcctcaaggaggcgaag
gaagccaaggaggcactggaggcaaaggagcgctacatggaggagatggcagacacagcc
gacgccatcgagatggccactctggacaaggagatggccgaggagcgggccgagtccctg
cagcaggaggtggaggcactgaaggaacgagtagacgaactcaccacagacttggagatc
ctcaaggctgaaattgaagagaaaggctctgatggggctgcgtccagctaccagctcaaa
cagctggaggagcagaatgcccgcctgaaggacgccctggtgaggatgcgagatctctct
tcctcagagaagcaggagcatgtgaagctccagaagctcatggaaaagaagaaccaggag
ctggaggttgtgaggcagcagcgtgagcgtcttcaggaggaactgagccaggcagagagc
accatcgatgagctcaaagagcaggtggacgctgctctgggagctgaggagatggtggag
atgctgactgaccggaacctgaatctggaggagaaagtgcgagaattacgggagactgtg
ggggacttggaagcgatgaatgagatgaatgacgagctgcaggagaacgcacgcgagaca
gaactggagctgcgtgagcagctggacatggcaggcgcccgagtaagggaggcccagaag
cgagtggaagccgcccaggagacggtcgccgactaccagcagaccatcaagaagtaccgc
cagttgactgcccacctacaggatgtcaatcgggagctgaccaaccagcaggaagcgtct
gtggagagacagcagcagccaccgccagagacttttgatttcaaaatcaagtttgctgag
accaaggctcatgccaaggcgatcgagatggagttgaggcagatggaagttgcccaggcc
aaccggcacatgtccctgctgacggcctttatgcctgacagcttccttcggccaggggga
gaccatgactgtgtcctggtgctgctgctcatgccccgactcatctgcaaggcagagctc
atccggaagcaggcccaggagaagtttgacctgagtgagaactgttcggagcggcctggg
ctgcgaggggctgctggggagcagctaagctttgccgccgggctggtgtactcgctgagt
ctgctgcaggccacactgcaccgctacgagcatgccctctctcagtgcagcgtggacgtg
tacaagaaggtaggcagcctgtacccggagatgagtgcccacgagcgctccttagatttc
ctcatcgagctgctgcacaaggatcagctggacgagactgtcaacgtggagcccctcacc
aaggccatcaagtactaccagcatctgtacagcatccacctcgctgagcagcccgaggag
tccaccatgcagctggctgaccacatcaagttcacccagagtgccctggattgtatgagc
gtggaggtggggcggctgcgtgccttcttgcagggtgggcaggaggcaacagatattgct
cttcttctgcgagacctggaaacatcctgcagtgacatccgtcagttctgcaagaagatc
cgacggcgaatgccagggacggatgctcctgggatcccagcagcgctggccttcggctca
caggtgtctgacacactcctggactgcaggaagcacctgacgtgggtggtagctgttctg
caggaggtggcagctgcagccgcccagctcatcgcccccttggcagagaacgaggggctg
cccgtggctgcactggaggagctggctttcaaagcaagcgagcagatctacgggagcccc
tccagcagcccctacgaatgtctgcgccagtcatgctccatcctcatcagcacgatgaac
aagttggccacagccatgcaggaaggcgagtatgacgcagagcggcccccgagcaagcct
cctccagttgaaccttggcctgcagcactgcgtgcagagatcacagatgctgaaggtctg
ggtttgaagcttgaggatcgagagacagtcatcaaggagttaaagaagtcactcaagatt
aagggagaggagctgagtgaggccaacgtgcggctgagcctcctggagaagaagctggac
agcgctgccaaggatgctgatgagcgaatcgagaaagttcagactcggctggaggagacg
cagaccctgctacggaagaaggagaaagagtttgaggagacaatggatgcactccaggct
gacatagaccagctggaggcagagaagacagagctcaagcagcgcctgaacagccagtcc
aagcgcactattgagggactccggggcccccctccatcaggcattgctaccctggtctct
ggcattgctggtgaggaacaacagcgagggggcactcctgggcaggctccaggcgccttg
ccaggcccggggccggtgaaggactcaccactgctgcttcagcagatctctgccatgagg
ttacacatctctcagctccagcatgagaacagcatcctcagaggagcccagatgaaggcg
tccttggcagctctgccccctctgcatgttgcaaagttttccctcccaccccatgagggc
cctggtggtaacctcctgtctggggcactgtatcgcaagaccagccagctgttggagaaa
ctaaaccaactgagcacttacacccacgtagtagacatcacccgaagcagcccggcctgc
aagagcccatccgctcagcttatggaacaagtggcccagctcaagtctctgagcgacacc
atcgagaagctcaaggatgaggtcctcaaggagacagtaactcagcgtcctggagctact
gttcccactgactttgccaccttcccttcatctgccttcctgagggccaaggaagagcag
caagacgacacagtctacatgggcaaagtgaccttctcgtgtgcggcaggcctcggacag
cgacaccgcctggtgctgacccaggagcagctgcaccagcttcacggtcgtctcatctcc
taa

DBGET integrated database retrieval system