KEGG   Rattus norvegicus (rat): 29168Help
Entry
29168             CDS       T01003                                 

Gene name
Ubd
Definition
(RefSeq) ubiquitin D
  KO
K12157  ubiquitin D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    29168 (Ubd)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   29168 (Ubd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD TBK1_ULD Ubiquitin_2 DUF4885
Motif
Other DBs
NCBI-GeneID: 29168
NCBI-ProteinID: NP_445751
RGD: 69418
Ensembl: ENSRNOG00000000768
Vega: OTTRNOG00000001452
UniProt: Q921A3 A0A0G2JSG8
Position
20p12
AA seq 161 aa AA seqDB search
MASCVCVVHSEQWPLMTFDTTMSDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRALS
SYGIDKENTIHLTLKVVKPSDEELPLSLVESGDEGQRHLLRVRRSSSVAQVKEMIENVTA
VPPKKQFVNCNGKRLEDGKIMADYNIKSGSLLFLTAHCIGG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctgcgtctgtgttgtccattcggagcaatggccattaatgacctttgacacc
accatgagtgacaaagtgaagaaaatcaatgagcatattaggtcccaaaccaaggtctct
gtgcaggaccagatccttctgctagactccaagatcctcaagccccatagagcgttgtca
tcttatgggatcgacaaggaaaacactatccacctcaccctaaaggtggtgaagcccagt
gatgaagagctgcccttgtctctggtggagtcgggcgacgaggggcaaaggcacctcctt
cgagttcgaagatccagctccgtggcccaggtgaaggaaatgatcgagaatgtgactgct
gtgcctcccaagaagcagttcgtgaattgcaatggaaagaggctggaagatggaaagatc
atggccgactacaacatcaagagtggtagtttgctctttctcacagcgcactgcattggg
gggtga

DBGET integrated database retrieval system