KEGG   Rattus norvegicus (rat): 291685
Entry
291685            CDS       T01003                                 

Gene name
Srp19
Definition
(RefSeq) signal recognition particle 19 kDa protein
  KO
K03105  signal recognition particle subunit SRP19
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    291685 (Srp19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    291685 (Srp19)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   291685 (Srp19)
SSDB
Motif
Pfam: SRP19
Other DBs
NCBI-GeneID: 291685
NCBI-ProteinID: NP_001099627
RGD: 1308437
Ensembl: ENSRNOG00000020204
UniProt: B2RZ66
Position
18
AA seq 144 aa
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPINKAVENPTATEIQDVCSAVGLNA
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQ
KSGGADPSLQQGEGSKKGKGKKKK
NT seq 435 nt   +upstreamnt  +downstreamnt
atggcatgcgctgccgcgcggtccccggccgaccaggacaggtttatttgtatctacccc
gcttatttaaataataagaagaccatagctgaggggaggcggatccccattaataaggct
gtagaaaaccccacggctactgagattcaggatgtatgttcagcagttggactgaatgcg
tttctggagaaaaacaaaatgtactccagagaatggaatcgtgatgttcagtatagaggc
agagttcgggtacagctcaaacaggaagatggcagcctctgtcttgtacagttcccatca
cgtaagtcggtgatgctgtacgtagcagaaatgatacccaagctaaaaacaaggactcag
aagtcaggaggtgctgacccaagtcttcagcagggagaggggagtaagaaagggaaagga
aagaagaagaaatga

DBGET integrated database retrieval system