KEGG   Rattus norvegicus (rat): 29173Help
Entry
29173             CDS       T01003                                 

Gene name
Csn2, Csnb
Definition
(RefSeq) casein beta
  KO
K17107  beta-casein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    29173 (Csn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29173 (Csn2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   29173 (Csn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Casein
Motif
Other DBs
NCBI-GeneID: 29173
NCBI-ProteinID: NP_058816
RGD: 61981
Ensembl: ENSRNOG00000039326
UniProt: P02665 G3V9R5
Position
14p21
AA seq 231 aa AA seqDB search
MKVFILACLVALALAREKDAFTVSSETGSISSEESVEHINEKLQKVKLMGQVQSEDVLQN
KFHSGIQSEPQAIPYAQTISCSPIPQNIQPIAQPPVVPTVGPIISPELESFLKAKATVLP
KHKQMPFLNSETVLRLFNSQIPSLDLANLHLPQSPAQLQAQIVQAFPQTPAVVSSQPQLS
LPQSKSQYLVQQLAPLFQQGMPVQDLLQYLDLLLNPTLQFLATQQLHSTSV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttcatccttgcctgccttgtggcacttgctcttgcaagggagaaggatgca
ttcactgtgtcctctgagactggtagtatttccagtgaggaatccgttgaacatatcaat
gagaaacttcagaaggtgaaactcatgggacaggtgcagtccgaggatgtgctccagaat
aaatttcactccggcattcagtcagaaccccaggccattccatatgcccagaccatctct
tgcagtcccattccacaaaacatccagcctattgctcaaccccctgtggtgccaactgtt
gggcctatcatttctcctgaactggaatccttccttaaagctaaagccactgtccttccc
aagcacaaacagatgcccttccttaactctgaaaccgtgctccgcctctttaactctcaa
atccccagtcttgatcttgctaatctgcaccttcctcagtctccagcccagctccaggca
caaattgtgcaggcttttcctcagactcccgcggtggtttcttctcagccccagctgtct
cttcctcagtccaaaagtcagtaccttgtgcagcaactagcacccctcttccaacaaggt
atgcctgttcaagaccttctgcagtacctagatcttctgcttaaccccaccctccagttc
cttgccactcaacaacttcattccacttctgtctaa

DBGET integrated database retrieval system