KEGG   Rattus norvegicus (rat): 29174Help
Entry
29174             CDS       T01003                                 

Gene name
Ctsj, Ctsp
Definition
(RefSeq) cathepsin J
  KO
K09599  cathepsin P [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    29174 (Ctsj)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29174 (Ctsj)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     29174 (Ctsj)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   29174 (Ctsj)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 29174
NCBI-ProteinID: NP_058817
RGD: 69241
Ensembl: ENSRNOG00000046476
UniProt: Q63088
Position
17p14
AA seq 334 aa AA seqDB search
MTPAVFLVILCFGVASGAPARDPNLDAEWQDWKTKYAKSYSPVEEELKRAVWEENLKMIQ
LHNKENGLGKNGFTMEMNAFADTTGEEFRKSLSDILIPAAVTNPSAQKQVSIGLPNFKDW
RKEGYVTPVRNQGKCGSCWAFAAVGAIEGQMFSKTGNLTPLSVQNLLDCSKSEGNNGCRW
GTAHQAFNYVLKNKGLEAEATYPYEGKDGPCRYHSENASANITGFVNLPPNELYLWVAVA
SIGPVSAAIDASHDSFRFYSGGVYHEPNCSSYVVNHAVLVVGYGFEGNETDGNNYWLIKN
SWGEEWGINGFMKIAKDRNNHCGIASQASFPDIF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctgctgtctttctggtgatcctgtgctttggagtggcctcaggtgccccagca
cgtgatcccaatttggatgctgaatggcaagactggaagactaaatatgcaaaatcatat
agcccggtggaagaagaactgaagagggcagtatgggaagaaaacttgaaaatgatccaa
ctgcacaacaaggagaatggcctggggaagaatggcttcactatggaaatgaatgccttt
gctgatacaactggtgaagaattcagaaaatcattgagtgatattctaattccggctgct
gtgacaaacccaagtgcccagaaacaagtctctattggtttacccaactttaaggattgg
agaaaggaaggctatgtgactcctgtacggaatcagggtaaatgcggctcttgttgggct
tttgctgcagttggtgcgatagaaggtcagatgttctcaaaaactggcaacctcacccct
ctaagtgtgcagaatctattggactgttctaaaagtgaaggaaataatggctgccgttgg
ggtactgcacaccaagcattcaattatgttttgaaaaataaaggtcttgaggctgaggca
acctatccatatgaaggaaaagacggaccctgcaggtaccacagtgagaacgctagtgct
aacatcacaggttttgtgaacctcccaccgaatgagctttacctatgggttgctgtagca
tctattgggcccgtctctgcggcaattgatgcttctcatgactctttcagattctacagt
ggaggtgtttatcatgagccaaattgcagcagttatgttgtgaatcatgcagtgctggtg
gttggctatggatttgagggaaatgaaacagatggcaataactactggctgatcaagaac
agttggggtgaagaatggggcattaatggcttcatgaagatagccaaagatcgcaacaac
cactgtggaattgcttcacaagccagcttccccgatatattctga

DBGET integrated database retrieval system