KEGG   Rattus norvegicus (rat): 29175Help
Entry
29175             CDS       T01003                                 

Gene name
Ctsk
Definition
(RefSeq) cathepsin K
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    29175 (Ctsk)
  Cell growth and death
   04210 Apoptosis
    29175 (Ctsk)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    29175 (Ctsk)
  Development
   04380 Osteoclast differentiation
    29175 (Ctsk)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    29175 (Ctsk)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     29175 (Ctsk)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C1: papain family
   29175 (Ctsk)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   29175 (Ctsk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 29175
NCBI-ProteinID: NP_113748
RGD: 61810
Ensembl: ENSRNOG00000021155
UniProt: O35186
Position
2q34
AA seq 329 aa AA seqDB search
MWVFKFLLLPVVSFALSPEETLDTQWELWKKTHGKQYNSKVDEISRRLIWEKNLKKISVH
NLEASLGAHTYELAMNHLGDMTSEEVVQKMTGLRVPPSRSFSNDTLYTPEWEGRVPDSID
YRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGG
YMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVA
RVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGE
SWGNKGYVLLARNKNNACGITNLASFPKM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgttcaagtttttgctgctacccgtggtgagctttgctctatccccggaggaa
acgctggacacgcagtgggagctgtggaagaagacccacgggaagcagtacaacagcaag
gtggatgaaatctctcggcgtttaatttgggaaaaaaacctgaagaaaatttctgtccat
aatcttgaggcctctcttggtgcccatacgtatgagctggccatgaatcacctgggagac
atgaccagcgaagaagtggttcagaagatgactggactcagagtgccaccttcgcgttcc
ttcagtaatgacactctctataccccagagtgggaaggcagagtcccagactccatcgac
tatcgaaagaaaggctatgttactccagtcaaaaaccagggccagtgtggttcctgttgg
gctttcagctctgcgggtgccctggagggccaactcaagaagaaaactggcaaactctta
gctctgagtccccagaatcttgtggactgtgtgtctgagaactatggctgtggaggcggc
tatatgaccactgccttccaatatgtgcagcagaatggaggcattgactctgaagacgct
tacccgtatgtggggcaggatgaaagttgtatgtataacgccacggcaaaggcagctaag
tgcagagggtacagagagatccctgtggggaacgagaaagccctgaagagagcagtggct
cgggtaggacccgtctctgtgtccatcgatgcaagcttgacatctttccaattttacagc
agaggtgtgtactatgacgaaaactgcgaccgtgataatgtgaaccatgccgtgttggtg
gtgggctatggcacccagaagggaaataagtactggataattaaaaacagctggggagaa
agctggggaaacaaaggctatgttctcttggctcggaataagaacaatgcctgtggcatt
accaacctggccagcttccccaagatgtga

DBGET integrated database retrieval system