KEGG   Rattus norvegicus (rat): 29175Help
Entry
29175             CDS       T01003                                 

Gene name
Ctsk
Definition
(RefSeq) cathepsin K
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    29175 (Ctsk)
  09143 Cell growth and death
   04210 Apoptosis
    29175 (Ctsk)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    29175 (Ctsk)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29175 (Ctsk)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    29175 (Ctsk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29175 (Ctsk)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    29175 (Ctsk)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     29175 (Ctsk)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   29175 (Ctsk)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   29175 (Ctsk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 29175
NCBI-ProteinID: NP_113748
RGD: 61810
Ensembl: ENSRNOG00000021155
UniProt: O35186
Position
2q34
AA seq 329 aa AA seqDB search
MWVFKFLLLPVVSFALSPEETLDTQWELWKKTHGKQYNSKVDEISRRLIWEKNLKKISVH
NLEASLGAHTYELAMNHLGDMTSEEVVQKMTGLRVPPSRSFSNDTLYTPEWEGRVPDSID
YRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGG
YMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVA
RVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGE
SWGNKGYVLLARNKNNACGITNLASFPKM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgttcaagtttttgctgctacccgtggtgagctttgctctatccccggaggaa
acgctggacacgcagtgggagctgtggaagaagacccacgggaagcagtacaacagcaag
gtggatgaaatctctcggcgtttaatttgggaaaaaaacctgaagaaaatttctgtccat
aatcttgaggcctctcttggtgcccatacgtatgagctggccatgaatcacctgggagac
atgaccagcgaagaagtggttcagaagatgactggactcagagtgccaccttcgcgttcc
ttcagtaatgacactctctataccccagagtgggaaggcagagtcccagactccatcgac
tatcgaaagaaaggctatgttactccagtcaaaaaccagggccagtgtggttcctgttgg
gctttcagctctgcgggtgccctggagggccaactcaagaagaaaactggcaaactctta
gctctgagtccccagaatcttgtggactgtgtgtctgagaactatggctgtggaggcggc
tatatgaccactgccttccaatatgtgcagcagaatggaggcattgactctgaagacgct
tacccgtatgtggggcaggatgaaagttgtatgtataacgccacggcaaaggcagctaag
tgcagagggtacagagagatccctgtggggaacgagaaagccctgaagagagcagtggct
cgggtaggacccgtctctgtgtccatcgatgcaagcttgacatctttccaattttacagc
agaggtgtgtactatgacgaaaactgcgaccgtgataatgtgaaccatgccgtgttggtg
gtgggctatggcacccagaagggaaataagtactggataattaaaaacagctggggagaa
agctggggaaacaaaggctatgttctcttggctcggaataagaacaatgcctgtggcatt
accaacctggccagcttccccaagatgtga

DBGET integrated database retrieval system