KEGG   Rattus norvegicus (rat): 291754
Entry
291754            CDS       T01003                                 

Symbol
Dsg4
Name
(RefSeq) desmoglein-4 precursor
  KO
K07599  desmoglein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    291754 (Dsg4)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Major cadherins
   291754 (Dsg4)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR Cadherin_3 Tweety
Other DBs
NCBI-GeneID: 291754
NCBI-ProteinID: NP_955784
RGD: 735015
Ensembl: ENSRNOG00000022364
UniProt: Q6W3B0
Position
18:11720975..11756234
AA seq 1040 aa
MDWLLFRNICLLILFMVVLGVNSEFIVEVKELDIENGTTTWQTVRRQKREWIKFAAACRE
GEDNSKRNPIARIRSDCEVSQRITYRISGAGIDRPPYGVFTINPRTGEINITSVVDREIT
PLFLIHCRALNSRGEDLERPLELRVKVMDVNDNPPVFTQNVYTANIEENSDANALVVKLS
ATDADEDNHLNSKIAYKIISQEPAGAPMFMVNRYTGEVRTMSNFLDREQHSMYNLLVRGS
DRDGATDGLSSECDCRIKILDVNDNFPILEKTSYSASIEENCLSSELIRLQAIDLDEEGT
DNWLAQYSILSGNDGNWFEIQTDPKTNEGILKLVKMLDYEQEPNIYLSIGVRNQAEFHHS
VASQFQMHSTPVRIQVINVREGPTFRPSSMTFSLRGGMRGDSLMNYVLGTYTAIDMDTGS
PATNVRYVIGHDAGSWLKVDSRTGEIQFSREFDTKSKYITDGMYAAEILAIDDGSGRTAT
GTICIEVPDANDYCPVIYAESRSVCTHASSVRIYVNDHSFGAPFTFCVVDESPDTADIWD
IRSINGTSAILMTEQTLSPGPYQIPILVKDSHNRACELPQTVLLDACLCDDYHVCLHSST
TGIYTGDTIWVTDDMGTVTDDGLRQSNVGLGPAGIGMIILGLLLLFLSPLLLLMCCCKRR
QPEGLGTRFAPVPEGGEGVMQPWRIEGAHPEDRDVSNICVPMTASNTQDRIDSSEIYTNT
YAGGGTVEGGVSGVELNTGVGTAAGIAAGGATGTLRKRSSTIGTLREYQDTGMNMAFLDS
YFSEKAYAYADEDEGRPANDCLLIYDHEGTGSPVGSIGCCSWIVDDLDESYMETLDPKFR
TLAEICLDTEIEPFPSHQACIPISTDLPLLGPNYFVNESSGMTLSEAEFQAEMAAASEPM
IHGDIIVTETYTATDPCVQPTTIVFDSQLPPNVVVTETVMAPVYDVQGNICVPAEIANTH
NVYYAERVVASPGVPDMGNGNIGDTCIGPVMSGGILVGPEIQVTQMMSPDIHISQTTRST
SPMTSQHRVTRYSNIHYSRQ
NT seq 3123 nt   +upstreamnt  +downstreamnt
atggactggcttctcttcagaaatatttgccttctgatcctatttatggtggtcctagga
gtgaacagtgaatttatcgttgaggtaaaagaattagacatagaaaacggcaccacaacc
tggcagactgtcaggaggcagaagcgagagtggatcaagtttgcagcggcctgtcgggag
ggcgaggacaactccaagaggaatccgattgccagaattagatcagactgtgaagtgagc
cagaggatcacttatcgaatctctggagcggggattgatcggccgccttatggagtgttc
accatcaaccctcggactggagaaatcaacattacctcagtagtggacagagagataacc
ccactgttcctgatccattgccgagctctcaactcgagaggagaagacctggagagaccg
ctggagctcagagtgaaagtcatggatgtaaatgacaaccctccagtcttcactcagaac
gtgtacacagccaacattgaagaaaacagtgatgcaaatgcactggtggtgaagttaagt
gccacggatgcagatgaagacaatcacttgaattctaaaattgcttacaagatcatctcc
caggagcctgctggtgcacccatgttcatggtgaacaggtacactggagaagtccgcacg
atgtccaacttccttgacagagagcaacacagtatgtacaatctcctggtgaggggctca
gatcgggatggagccacagatgggctgtcctctgaatgtgactgcagaatcaagattttg
gatgtcaatgataatttccccatcttggagaaaacctcatactcagcaagtattgaagaa
aactgtttgagctcagaactgatacgactgcaagcaatcgatctcgatgaggaaggcact
gataactggctggcccaatactccatcctctctggcaatgatgggaactggtttgaaatc
caaacagatccaaaaaccaacgaaggcattttgaaattggtcaagatgctggactatgaa
caggaacctaacatttacctcagcattggagttagaaaccaagctgagtttcaccattca
gtggcatctcaattccaaatgcactccactcccgtgagaatccaggttattaacgtgcgg
gaaggaccaacctttcgcccaagttccatgacatttagtctacgaggaggaatgagggga
gactccttaatgaactatgtgcttggcacatacacagccatagatatggacacggggagc
cctgcaacaaacgtcaggtatgtcatagggcacgatgcaggcagctggctaaaagttgat
tcaaggactggtgagatacagttttctagggaatttgacacgaagtcaaaatatattacg
gatgggatgtatgcagcagagatcctggctatagatgatggctctgggagaacagctacg
ggaaccatatgcattgaggttcctgatgccaatgattactgtcccgtcatttatgccgaa
agtagaagtgtctgcacccatgcttcgtctgtcaggatctacgtcaacgaccattctttc
ggggctccctttaccttttgtgtggttgacgagtcgccagacacagctgacatatgggat
atcaggtccatcaatggaacttctgcaatccttatgactgagcagaccttgtctccagga
ccctaccaaatccccatcctcgtgaaggacagtcacaacagagcatgtgaattgccacag
actgtactgttagacgcctgcttgtgtgacgactaccatgtgtgcttgcactccagcacc
acaggcatctacactggggacaccatctgggtgaccgatgacatggggacggtcactgat
gatggacttaggcagtcaaacgtcggacttggcccagcggggattggcatgattattttg
ggtctcttgctgctgttcttgtcaccccttttactgctcatgtgctgctgcaagaggaga
cagccagaaggcctggggacaaggtttgcccctgtgcctgagggaggcgaaggagtgatg
cagccctggagaatcgagggggctcatccggaagacagggatgtatcaaatatatgtgtg
cccatgacagcctctaacacccaagatcgcattgattcctctgaaatctacaccaacact
tatgctggtggaggaacagtggaagggggtgtgtcaggagtggagctcaatacaggtgtt
gggacagctgcaggcatagcagctggaggagcaacagggaccctgagaaagaggagttca
actatagggactcttcgggaataccaagacaccggcatgaacatggccttcctggacagc
tacttctctgagaaagcgtatgcgtatgcagatgaagatgaaggccgtccagccaatgat
tgcctgctcatttatgaccatgaaggaactggctcacccgtgggctccattggctgctgc
agttggattgtggatgacttagatgagagctacatggagactttagatccaaagttcagg
actctagctgaaatctgcttggacacagagattgaaccattcccctcacaccaggcctgt
ataccaataagcactgacctccctctgctggggcctaattactttgtcaatgaatcttca
ggaatgactctctcggaggctgaattccaagcagaaatggcagcagcctctgaacccatg
attcatggggacatcatagtgactgaaacttacactgccactgacccatgtgtacaaccc
acgacgattgtctttgactctcagcttccacccaatgtagtcgtgaccgaaaccgtgatg
gcacctgtctatgatgttcaagggaacatctgtgtgcctgccgagatagccaacacacac
aatgtatactacgctgagagagtggtggctagccctggtgtgcctgacatgggcaacggt
aacataggtgatacatgtataggaccagtgatgagtggtggtattttggtagggccagaa
attcaagtgacacaaatgatgagcccagacattcacataagccaaaccacacgctctacc
tccccaatgacgtctcaacaccgagtaaccagatacagcaacatacactactcccgacag
taa

DBGET integrated database retrieval system