KEGG   Rattus norvegicus (rat): 29177Help
Entry
29177             CDS       T01003                                 

Gene name
Hpca
Definition
(RefSeq) hippocalcin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 29177
NCBI-ProteinID: NP_058818
RGD: 620060
Ensembl: ENSRNOG00000006979
UniProt: P84076
Position
5q36
AA seq 193 aa AA seqDB search
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcagaatagcaagctgcggccagagatgctgcaggacctgcgagagaacacc
gagttctctgagctggagcttcaggagtggtacaagggcttcctgaaggactgcccgact
ggcatcctcaacgtggatgagttcaagaagatctacgccaacttcttcccctacggcgat
gcctccaagttcgccgagcatgtcttccgcacttttgacaccaacagcgacggcaccatc
gacttccgggagttcatcatcgctctgagcgtgacctcgcgtggccgcctggagcagaag
ctcatgtgggccttcagcatgtacgacctggacggcaatggctacatcagccgggaggag
atgctagaaattgtgcaggccatttacaagatggtttcgtccgtgatgaagatgcctgag
gatgagtctaccccggaaaagaggactgagaaaatcttccgccaaatggacacaaacaat
gacggcaagctgtcactggaggagttcatccgcggggccaaaagcgacccatcgatcgtg
cgcctgctgcaatgcgatcccagcagcgcttcccagttctga

DBGET integrated database retrieval system