KEGG   Rattus norvegicus (rat): 291773
Entry
291773            CDS       T01003                                 

Gene name
Taf4b
Definition
(RefSeq) transcription initiation factor TFIID subunit 4B isoform X1
  KO
K03129  transcription initiation factor TFIID subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    291773 (Taf4b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    291773 (Taf4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    291773 (Taf4b)
   03036 Chromosome and associated proteins [BR:rno03036]
    291773 (Taf4b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     291773 (Taf4b)
   Coactivators
    SAGA/TFTC/STAGA complex
     291773 (Taf4b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     291773 (Taf4b)
SSDB
Motif
Pfam: TAF4 TAFH
Other DBs
NCBI-GeneID: 291773
NCBI-ProteinID: XP_006254501
RGD: 1562997
Ensembl: ENSRNOG00000026023
Position
18
AA seq 852 aa
MPAGLTGPAGAAAPVVSSASGTVTMAPVAALPVRVESTPVALCPVTKAPVNVCVDSVAPQ
SLPAPVGTLVTKVVPVTALPKLGGPRLPAPQIVTVKTPSTTTIQLPANLQLPPGTVLIKS
NSGQLMLVSPQQAVAGTKTTSTITPRPAVPANTQTVKICTVPNSSSQLMKKVTVAPVKSL
TQIGTTVATTASSASSGQPVTVPSNVVTVTPAKPVNNVSILKSSSLGILSTPSNDSSLKA
ETSVSAQTSLPPTVLENVKKCKNFLSMLIKLACSGSQSPEMGQNVKKLVEQLLDAEIEAE
EFTRKLYIELKSAPQPHLVPFLKKSVVALRQLLPNSQSFTENCVQEVSGDVVIPSCAMTT
ATSPAVTSTVSPVIVSGAAVPRTLSVQQTLNSLAGPGGANTGVVTLHSVTPATATGGTTA
TTVLLQTPKPLTTPVPNTVAAVSLQPENPVVSGAAVALAVPSATLGEASAQALCLPSVKT
AITSAGTKAEKAAISTPVQITLAQPGPLLPQSAGIPQAGKAKQLIVQQPSVGNANHVISI
SHSSPLSSQTCGQKAPVTAVMPTASIIKQISLPGNKLLSLQAQTTSIQNNKIKENGPACF
RGEDDINDVTCMAEVNLDEENACILATHSDFVGKLIQSCKDEPFLLIGALQKRILDIGKK
HDITELNSDAVNLISHATQERLRGLLEKLTAIAQHRMTIYKGSENYILSTDTRSQLKFLE
KLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQYRDANLTA
LAAIGPRKKRPLESGNESFKDNPSASGTCSLTATRPLLRPRITRVSLRDLIFCMEQERGM
KYSRALYLALLK
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgccagcgggcctcacggggccggccggcgccgctgctcctgtagtctcgagcgcctcg
gggaccgtgactatggccccggtcgctgcgctgcctgtgcgggtggagagcaccccggtg
gccctgtgccctgtgactaaggcccctgtcaatgtctgcgtggattctgtggcgccccag
tccttgccagccccagtggggactctagtgaccaaagtggttcctgtcactgcccttcct
aaactcggcggccccaggctgcccgctcctcagatagtcaccgtgaaaactcccagcacc
acgacaatccaactaccggctaatttgcagcttcctccaggaacagttttgatcaaaagt
aacagtggtcagttgatgctggtttctcctcagcaagctgtagcaggaaccaagaccaca
agtaccataactccaagaccagcagtaccagcaaacactcaaacagtcaagatctgtaca
gtgccgaattctagctcacaattaatgaagaaagtgacggtggctcctgttaaaagtttg
acacagataggaactactgtggcaaccactgcctccagtgcttcctcaggacaacctgtg
actgtaccaagcaatgttgtcacagttactcctgcaaagccggtgaataatgtatccatc
ctgaagtcatcaagtttgggaatattatctactccctcaaatgactcgagtctaaaagcc
gagacgtcagtatctgctcagactagtcttcctccgacagttctagaaaatgtgaaaaaa
tgcaaaaacttcctttcaatgttaataaaactggcatgtagtggatcacagtctccagaa
atggggcagaatgtgaagaagctggtggaacaacttttggatgcagaaattgaagcagaa
gagtttactaggaaactatatattgaactcaagtctgcacctcagccgcaccttgtccct
tttcttaagaaaagtgtggttgccttaagacagcttcttccaaactcccagagcttcact
gagaactgtgttcaggaagtttctggtgatgtggtcattccctcctgtgccatgacaaca
gcaacttctcctgcggtgacaagtacagtttccccagtcattgtctctggagcagcagta
cccagaactctgtctgttcaacagactctgaattcacttgctggtccaggaggagcaaac
actggagttgtgacgctgcattctgtgaccccagccactgcaacaggaggtacaacagct
acaactgttttgcttcagactccaaaaccacttacaacaccagtaccaaatacagtggca
gcagtgtcccttcagcctgagaatccagtcgtgtctggggcagcagtagcactggctgtc
ccctcagcaactctgggagaagcgtcagctcaagctctctgtcttccatctgtgaagact
gccattacctctgctgggaccaaagccgagaaagctgccattagcactccagtccagatc
acactggcacagccaggccccctccttccacagtctgctggcattccacaggcaggcaaa
gccaagcaactaatagtccagcagccttcagtaggcaatgccaatcatgtgatctccatt
tcccattcctcaccattgagctctcagacctgtgggcagaaggcaccagtgactgctgta
atgcctactgcttccatcataaagcaaattagtctgcctggaaataaacttttgtcgctt
caagctcaaacaacttctattcagaacaataaaataaaagaaaatggaccagcatgcttc
agaggggaagatgacatcaatgatgtgacttgcatggcagaggtcaaccttgatgaggaa
aatgcctgcatcttagcaacacattctgactttgttggcaaactcattcagtcatgcaaa
gacgaaccttttcttctcattggagctctacaaaagagaattttagacattggtaaaaag
catgacattacggagcttaactctgatgctgtgaacttgatctcccatgcaacacaggag
agattacgaggccttctagagaaactaactgcaattgctcagcatcgaatgactatttac
aagggaagtgaaaattacatcttgtctactgataccagatcacagctcaaatttcttgaa
aagctggatcaattggagaagcagaggaaggatttagaagagagagaaatgttactgaag
gcagccaagagccgctccaataaagaagatccagaacagctgagattaaaacagaaagcc
aaagagttgcagcagttggaactcgcccagatccaatatagagatgctaatctcacagct
cttgcagccattggaccacggaagaagagaccactagaatcaggaaatgagagcttcaaa
gacaacccttctgcttccgggacttgcagcctaacagccaccagaccactgcttcgtcca
agaatcacaagagtcagcctcagggacttgatattctgtatggaacaggaaagagggatg
aagtactctcgagccctgtaccttgcccttctcaagtga

DBGET integrated database retrieval system