KEGG   Rattus norvegicus (rat): 291787Help
Entry
291787            CDS       T01003                                 

Gene name
Rbbp8, CtIP, RBBP-8, RGD1308872, RIM, SAE2
Definition
(RefSeq) RB binding protein 8, endonuclease
  KO
K20773  DNA endonuclease RBBP8 [EC:3.1.-.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    291787 (Rbbp8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    291787 (Rbbp8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     291787 (Rbbp8)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-C complex
     291787 (Rbbp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CtIP_N SAE2
Motif
Other DBs
NCBI-GeneID: 291787
NCBI-ProteinID: NP_001127889
RGD: 1308872
Ensembl: ENSRNOG00000012899
UniProt: B1WC58
Position
18p13
AA seq 893 aa AA seqDB search
MSISGSSCGSPNSTDISSDFKELWTKLKEYHDKEVQGLQIKVTKLKKERILDAQRLEEFF
TKNQQLRDQQKVLQETIKILEDRLRAGLCDRCAVTEEHMHKKQQEFENIRQQNLRLITEL
MNEKSALQEENKKLSEQLQQKMESGQQDQVAELECEENIIPDSPITSFSFSGINRLRRKE
NLHVRYVEQTHTKLEHSACTSELRKFSKGSTPAPVNSEEHEILVADTCDQSHSPLSKICG
TSSYPADKLSSNLDAVVAETLGLDGQEESEPQGPVSPLGNELYHCLKEDHKKQPFMESAI
RNEDNVRFSDSASKAPPRELTTRGSSPVFGPTSTVKTHLGLKTSFSPSLLDSGKKNLLST
APFSSISVSRSEKVRSKSEDNALFTQQSAGSEVKVISQSFPSKQILTSKNVSDSVDEQGG
ADHMKDAVSDKHLVPLKSLGGKASKRKRTEEEGEHAVHCPQTCFDKENALPFPMENQFPV
NGDHVMDKPLDLSDRFAANQRQEKNHGDETCKHKLKQVTIYEALKPVPKGSSSGRKALSG
ACTLAQDSAETYCLQQRTLQCSSKFSPDHNTQLQIKEENPVFKTPPRSQESLETENLFGD
VKGIGSLVPIKVKGRSAHGGCELASVLQLNPCRVAKTKSLPSNHDMSFENIQWSVDPGAD
LSQYKMDVTVIDTKDSSHSRLGGETVDMDCTLVSETMLLKMKKQEQREKSPNGDIKMNDS
LEDMFDRTTHEEYESCLADNFSQVPDEEELSDTTKKPNIHGDKQDGIKQKAFVEPYFKDK
ERETSIQNFPHIEVVRKKEERRKLLGHTCKECEIYYADLPAEEREKKLASCSRHRFRYIP
TNTPENFWEVGFPSTQTCLERGYIKEDLDPCPRPKRRQPYNAVFSPKGKEQRT
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttcaggaagcagctgtggaagccctaattccacagatatatccagtgacttc
aaggagctctggacaaaactaaaagaatatcatgataaggaagtacaaggtttacaaatc
aaagtaaccaaactgaaaaaggaaagaattttagatgcacagagactagaagaattcttc
accaaaaatcaacagctgagagaccagcaaaaagttcttcaggaaaccattaaaatttta
gaagataggttaagagcaggactgtgtgatcgctgtgcagtaactgaagagcatatgcac
aaaaagcagcaggagtttgaaaacatccgacagcagaaccttaggcttatcacagagctc
atgaatgaaaagagcgctcttcaggaagaaaacaaaaagctttctgagcaactgcaacag
aaaatggaaagtggtcaacaggatcaagtagctgagcttgaatgtgaggaaaacattatt
ccagactcaccgataacttccttttccttttctggcattaaccgcctacgaagaaaggag
aatctccatgtccgatacgttgaacaaacgcacactaaattggagcactctgcatgtaca
agtgaattaagaaagttttccaagggttcaactcctgcaccagttaactctgaggaacat
gaaattctagtagccgacacttgtgatcagagtcattctccactgtctaaaatatgtgga
acaagcagttaccccgctgacaagttatcttctaacttagatgctgttgttgctgagacg
cttggacttgatggtcaagaagaatctgaaccccaaggtcctgtgagccctcttggaaat
gagctctaccactgtctcaaagaagatcacaaaaaacagccttttatggaatctgcaata
aggaacgaagataacgtaaggttttcagactctgcttcaaaggcccctccccgagaactc
actactcgggggtcatctcccgtgtttggacctacctctaccgtgaaaactcatttgggt
ttgaaaacaagtttctccccttcactcttagacagtgggaaaaaaaaccttctgagcaca
gctccctttagcagcatttctgtttctagatcagagaaagttagatccaaatcagaggat
aatgcccttttcacacaacaaagtgctgggtctgaggtaaaggtcatcagccagtcattt
cctagtaagcagattcttacaagtaaaaacgttagtgactctgtcgacgagcagggtggt
gctgatcacatgaaagatgctgttagtgataaacacctggtgcctttgaaatcactggga
ggcaaagcgtccaaaaggaagaggactgaggaagagggtgagcacgcagtacactgcccg
cagacctgttttgataaggaaaatgcccttccttttccaatggagaatcagttccctgtg
aatggagaccatgtgatggataaacctctggacctgtcagatcggtttgcagctaatcag
cgtcaagagaagaaccacggggatgaaacttgcaaacacaaacttaagcaagtgactatt
tatgaggctctgaagcccgttcccaagggctcctcctcaggccgcaaggccttgagtggg
gcctgcacactagcccaagactctgcagagacatactgcttacagcagcgcaccctccag
tgctctagtaaattctctccagaccataacactcaattacagataaaagaagaaaatcct
gttttcaaaacacctccacgttcacaggaaagtttggagacagagaatctttttggtgat
gtgaagggtattgggtctcttgtgccaataaaagtaaaaggcagatcagcccatggagga
tgtgagcttgcatcagttcttcagttaaacccctgcagagttgctaagacaaagtctctg
cccagcaaccacgatatgtcatttgaaaatatccagtggagtgtagatccgggagcagac
ctttctcaatataaaatggatgttactgtgatagatacaaaggacagcagtcactcacga
ctgggaggagagacagtggacatggactgtacattggtcagtgaaaccatgcttttaaaa
atgaagaaacaagaacaaagagagaaaagtccaaatggagacataaaaatgaatgatagc
ttggaagatatgtttgatcggacaacacatgaagaatatgaatcctgcttggcagataac
ttctcccaggtaccagatgaggaagaattgtctgataccacaaagaaacctaacatacac
ggtgataaacaagatggaatcaagcagaaagcatttgtggagccatattttaaagataag
gagagagaaactagcatacagaattttcctcatattgaggtagttcggaaaaaagaagaa
agaaggaaattgcttgggcacacatgtaaagaatgtgaaatttattacgcagatttgcca
gcagaagaaagagaaaagaagttggcttcctgctcaagacaccgatttcgctacattcca
accaacacaccagagaatttctgggaagttggttttccttctactcagacgtgtctggaa
aggggttatatcaaggaagatctcgatccttgtcctcgtcccaaaagacggcagccttac
aacgcagtcttttctccaaagggcaaagaacagaggacctag

DBGET integrated database retrieval system