KEGG   Rattus norvegicus (rat): 29179
Entry
29179             CDS       T01003                                 
Symbol
Syn2
Name
(RefSeq) synapsin-2 isoform 1
  KO
K19941  synapsin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29179 (Syn2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    29179 (Syn2)
SSDB
Motif
Pfam: Synapsin_C Synapsin Synapsin_N RimK LpxD
Other DBs
NCBI-GeneID: 29179
NCBI-ProteinID: NP_001029192
RGD: 3798
Ensembl: ENSRNOG00000008157
UniProt: Q63537
Structure
Position
4:148178846..148347010
AA seq 586 aa
MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQPPPAPGPGTATASAATSAASPGPERRP
PPAQAPAPQPAPQPAPTPSVGSSFFSSLSQAVKQTAASAGLVDAPAPSAASRKAKVLLVV
DEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFR
PDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTL
GGEKFPLIEQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQ
TYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDA
CSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLS
RTPALSPQRPLTTQQPQSGTLKEPDSSKTPPQRPAPQGGPGQPQGMQPPGKVLPPRRLPS
GPSLPPSSSSSSSSSSSSSAPQRPGGPTTTHGDASSSSNSLAEAQAPQAAPPQKPQPHPQ
LNKSQSLTNAFSFSESSFFRSSANEDEAKAETIRSLRKSFASLFSD
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgatgaacttcctgaggcgccggctgtcggacagcagcttcattgccaacctgcccaat
ggctacatgactgaccttcagcgcccggagccgcagcagcccccacccgcccctggcccc
ggtaccgctaccgcgtcggcggccacctcagctgcctcgcctggccccgagcgcaggccg
ccacccgcccaggcacccgcgccgcagccggcgccgcagcccgcgccgacgccgtcggtg
ggcagcagcttcttcagctcgctgtcgcaagccgtgaagcagacggccgcctccgccggc
ctggtggacgcgcccgcgccttcggccgcttccaggaaggccaaggtgctgctggtggtc
gacgagccgcacaccgactgggccaagtgctttcggggcaaaaaaatccttggagattat
gacatcaaagtagaacaggcagaattttcagagcttaacctggtggcccatgcggatgga
acctacgccgtggacatgcaggtactccggaatggcacaaaggttgtcaggtccttcagg
ccagacttcgtgctcatccgacagcatgcatttggcatggcggagaatgaagacttccgc
cacctggtcattggcatgcagtatgcaggcctccccagcatcaactcactggagtccatt
tacaacttctgtgacaagccatgggtgtttgctcagatggtggccatcttcaagacactg
ggaggggagaaatttccactcattgagcagacctactaccccaatcaccgagagatgctt
acacttcctacgtttcctgtcgtggtgaagattggccatgctcactcgggcatgggcaag
gtcaaagtggaaaatcactacgacttccaggacattgccagtgtggtggccctcacccaa
acctatgccacagcagaacccttcattgacgccaagtatgacatccgggttcagaagatt
ggcaacaactacaaggcttacatgaggacatccatctcagggaactggaagacaaacact
ggctccgcgatgctggagcagatcgccatgtcagaccggtacaagctctgggtcgacgcc
tgctctgagatgtttgggggcttggacatctgtgcagtcaaagctgtgcatggcaaagat
ggcaaagactacatttttgaggtcatggactgtagcatgccactgattggggaacaccaa
gtggaggacagacaactcatcactgatctagtcatcagcaagatgaaccagctattgtcc
aggactcctgccctgtctccacagagacctttaaccacccaacagccacagagtggaaca
cttaaggaaccggactccagcaagacccctcctcagcggccagccccccaagggggccct
gggcaaccccaaggaatgcagcccccaggcaaggtgctgcctccacgtcggctcccctcg
ggaccatcactgccaccttcttcctcttcctcctcctcttcctcctcctcttcctcggct
cctcagaggccgggcggccctaccaccacccacggtgatgcatcctccagcagcaactcc
ctggcagaggcccaggcacctcaggctgctccaccacagaagccccagcctcacccacag
ctcaacaagtcgcagtccctgacaaatgcgttcagcttctctgagtcctccttcttccgg
tcttcagccaatgaagatgaagccaaagcggagaccatccggagcttgaggaagtccttt
gccagcctcttttcagattag

DBGET integrated database retrieval system