KEGG   Rattus norvegicus (rat): 29185Help
Entry
29185             CDS       T01003                                 

Gene name
Cd37
Definition
(RefSeq) CD37 molecule
  KO
K06475  CD37 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    29185 (Cd37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29185 (Cd37)
   04090 CD molecules [BR:rno04090]
    29185 (Cd37)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29185 (Cd37)
CD molecules [BR:rno04090]
 Proteins
  29185 (Cd37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspannin
Motif
Other DBs
NCBI-GeneID: 29185
NCBI-ProteinID: NP_058820
RGD: 62035
Ensembl: ENSRNOG00000020699
UniProt: P31053
Position
1q22
AA seq 281 aa AA seqDB search
MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVSFVGLSFVPLQTWSKV
LSVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQ
ELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANGSEELFVPCS
CYNSTATNDSSGFDKLFLSQLSRLGPRAKLRQTADICALPAKAHIYREGCARSLQKWLHN
NIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccaagagagttgcctcagcctcatcaagtacttcctcttcgttttcaacctc
ttcttctttgtactaggaggcctgattttctgctttggcacctggatcctcattgacaag
accagcttcgtgtcctttgtgggcttgtccttcgtgccactgcagacctggtccaaggtc
ctgtcggtctcgggtgtcctcaccatggccctggctctcctgggctgtgtgggggctcta
aaggagctgcgctgtcttctgggcctgtatttcggaatgctgctgctcctgtttgccaca
cagattaccttggggatcctcatttccactcagcgagtccggctggagcgaagggtgcag
gaattggtgttacggaccatccagagctaccgcacgaatccggatgagacagctgctgag
gagagctgggactatgcgcagtttcagctgcgctgctgcggttggcaatctccgcgggac
tggaacaaggcccagatgctgaaagcaaacgggtccgaagagctctttgtgccctgctcc
tgctacaattccaccgcgaccaatgactcctccggctttgataagctctttctctcccag
ctaagccggctggggccgcgggcgaagctgaggcagactgctgacatatgtgcactcccc
gcaaaagcccatatataccgtgagggctgcgcgcggagcctccagaagtggctgcacaac
aatatcatctccatagtgggaatttgtctgggagtcggtcttcttgagctcggcttcatg
acactctcgatattcctgtgtagaaatctggatcacgtctatgaccggctggcccggtac
cgctag

DBGET integrated database retrieval system