KEGG   Rattus norvegicus (rat): 291874
Entry
291874            CDS       T01003                                 

Gene name
Nup93
Definition
(RefSeq) nucleoporin 93
  KO
K14309  nuclear pore complex protein Nup93
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    291874 (Nup93)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    291874 (Nup93)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    291874 (Nup93)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     291874 (Nup93)
SSDB
Motif
Pfam: Nic96 Nup84_Nup100 Clathrin
Other DBs
NCBI-GeneID: 291874
NCBI-ProteinID: NP_001011925
RGD: 1311525
Ensembl: ENSRNOG00000018564
UniProt: Q66HC5
Position
19p12
AA seq 819 aa
MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKA
SVLLGSRGLDISHISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKR
TFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQESEPSYVSDVSPPGRSSLDS
IEMAYARQIYIYNEKIVSGHLQPNLVDLCASVAELDDKSISDMWAMVKQMTDVVLTPATD
ALKSRSSVEVRMDFVKQALGYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIK
LPAPSPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVSRAQHQLGEFKTWFQEYMNSKD
RRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDITDNQSEVADKTEDYLWLKLNQ
VCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAIAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCMRRLNFVRLLMLYTRKFE
STDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDK
FTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLELMNKLLSPVVPQISAPQSNK
ERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIDRLKLV
PLNQESMEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSATRPQRVIED
RDSQLRSQARALITFAGMIPYRTSGDTNARLVQMEVLMN
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggatactgagggatttggtgagctccttcagcaagctgaacagcttgctgctgagacc
gaaggcatctctgagcttccacatgtagaacgaaatttacaggagatccagcaagcgggt
gagcgcctgcgttcccgtaccctcacacgaacatcccaggagacagcagatgtcaaggca
tcagttcttctcgggtcacgtggacttgacatatcccacatctcccagagactggagagt
ctgagtgcagccaccacttttgaacctctcgagcctgtgaaggacacggacattcagggc
ttcctgaagaatgagaaagataatgccttgctgtctgctatcgaagagtcccggaagagg
acctttggcatggctgaggagtatcatcgagagtcaatgctggtcgagtgggaacaggtg
aaacaaagaattctgcatacgctgctggcatcaggggaggatgcccttgacttcacccaa
gaaagtgagccgagttacgtcagcgatgtgagtcctcctggccgaagctctctggatagc
attgagatggcctatgcccggcagatctacatctataatgagaagatcgtgagtggacac
ctacagcccaacctggtggacctgtgtgcctctgtcgcagagctggatgacaagagcatt
tctgacatgtgggccatggtaaaacaaatgacagatgtggtcctgacaccggcaactgac
gccctgaagagccgaagcagtgtggaagtgcgcatggattttgtcaagcaggccttggga
taccttgagcagagttataaaaattacacccttgtgactgtctttggaaacctgcatcag
gcacagctgggcggtgtgcctgggacttaccagctggttcgcagttttctaaacattaag
ttgccagctccctcaccaggacttcaggatggagaggtagaaggccatccggtctgggcg
ttaatttattactgcatgcgctgtggagacctgcttgctgcatcacaagtcgtcagtcga
gcccagcaccagctgggggaatttaaaacctggttccaggaatacatgaacagcaaggat
agaagattgtctccagctactgagaacaaactccggcttcactaccgcagagccctcagg
aacaacacagacccctacaagcgagctgtgtactgtatcattgggagatgcgacatcacc
gacaaccagagcgaagtagcagacaagaccgaggactacctgtggttaaaactgaaccag
gtgtgtttcgatgatgacggcaccagctcgccacaagacaggctcactctctcacagttc
cagaagcagctgctagaggactatggcgagtcccacttcacggtgaaccagcagcccttc
ctctacttccaagtgctgttcctgactgcacagtttgaagctgccattgcctttctcttc
cgcatggagcggctgcgctgccatgctgtccatgtggccctggtgctgtttgagctaaag
ctgcttttaaagtcctccgggcagagtgctcagctcctcagccacgagcctggtgaccct
ccctgcatgcgacggctgaactttgtgcgtctactcatgctctacacccgcaagtttgag
tccacggacccaagagaagccctgcagtacttttacttcctcagggatgagaaagacagt
caaggagaaaacatgtttctgcgctgtgtgagtgagcttgtgatagaaagtcgagagttt
gatatgattcttgggaagctagagaatgacggaagtagaaagcctggagtcatagataag
tttaccagtgacacaaagcctattatcaacaaagttgcttccgtggcagaaaataaagga
ctatttgaagaagcagccaagctttatgaccttgccaagaatgcggacaaggtgctggag
ctgatgaacaagctgctaagccctgtggtcccacagatcagcgccccacagtctaacaag
gaaaggctgaagaacatggccctctccattgcagagcggtacagggctcagggaataagt
gcaaataagtttgtggactctacgttctatctcctcttggacctgatcaccttttttgac
gaatatcacagtggtcatattgacagagccttcgatattatcgaccgcttgaagctggtg
cctctgaatcaggaaagtatggaagaaagggtggctgccttcagaaacttcagtgacgaa
atcaggcacaacctctcggaagttcttctcgccaccatgaacatcctgttcacacagttt
aagaggctcaagggaacaagcccatcttcagcaaccaggccccagcgagtcatcgaagac
cgtgactctcaactccgaagtcaagccagagccctgattacctttgctgggatgataccg
taccggacgtctggggacactaatgccaggctggtgcagatggaggtcctgatgaattaa

DBGET integrated database retrieval system