KEGG   Rattus norvegicus (rat): 291885Help
Entry
291885            CDS       T01003                                 

Gene name
Mcm5
Definition
(RefSeq) minichromosome maintenance complex component 5
  KO
K02209  DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    291885 (Mcm5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    291885 (Mcm5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    291885 (Mcm5)
   03036 Chromosome and associated proteins [BR:rno03036]
    291885 (Mcm5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     291885 (Mcm5)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    291885 (Mcm5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     291885 (Mcm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_lid Mg_chelatase AAA_5 AAA_3 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 291885
NCBI-ProteinID: NP_001099640
RGD: 1306616
Ensembl: ENSRNOG00000014336
UniProt: E9PTS4
Position
19p11
AA seq 356 aa AA seqDB search
MLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLAD
GGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDET
KGEDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVITLHVSALTQTQAVEGEIDLAK
MKKFIAYCRARCGPRLSAEAAEKLKNRYIIMRSGARQHERDIDRRSSIPITVRQLEAIVR
IAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGNLSGVEGFTTQEDQEMLSRIEKQ
LKRRFAIGSQVSEHSIVQDFTKQKYPEHAIRKVLQLMLRRGEIQHRMQRKVLYRLK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggaccctggcacagccaagtcacagcttctgaagtttgtggagaagtgctct
cctattggggtgtacacatctgggaaaggcagcagtgctgctggcttgactgcctctgtg
atacgggacccctcatcgcgaaacttcatcatggaaggtggagccatggttctggctgat
ggtggggttgtctgtattgatgagttcgacaagatgcgggaagatgaccgtgtagcaatc
catgaggctatggagcagcagaccatctccattgccaaggctgggatcactaccaccttg
aactctcgctgctctgttctggctgcagccaattcagtatttggccgatgggatgagaca
aaaggggaggacaatattgacttcatgcctaccatcttgtcccgatttgacatgatcttt
atcgtcaaagatgagcacaatgaggagagggacatgatgctggccaaacatgtgatcact
ctgcatgtgagtgcactgacacagacacaggctgtggagggtgagatcgaccttgccaag
atgaagaagttcattgcttactgccgagcgaggtgtggacctcggctatcagcagaggca
gcagagaagctgaagaaccgctacatcatcatgcggagtggggctcgtcagcatgagagg
gatattgaccgtcgttccagcatccccatcacagtgcggcagctggaggcgatcgtgcgc
atcgccgaggccctcagcaagatgaaactgcagccctttgctacggaggccgacgtcgag
gaggcgctgaggctcttccaggtgtccacgctggacgccgctttgtctggcaatctgtcg
ggggtggaaggcttcacgacccaggaggaccaggagatgctgagtcgcattgagaagcaa
ctcaagcgccgttttgctatcggctcccaggtgtctgaacacagcattgtccaggatttc
accaaacagaagtatccagagcatgccatccggaaggtgctgcagctcatgctgcgcagg
ggggagatccagcaccgcatgcagcgcaaggtgctttaccgcctcaagtga

DBGET integrated database retrieval system