KEGG   Rattus norvegicus (rat): 29190
Entry
29190             CDS       T01003                                 

Gene name
Pdyn
Definition
(RefSeq) prodynorphin
  KO
K15840  proenkephalin B (prodynorphin)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno05017  Spinocerebellar ataxia
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29190 (Pdyn)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    29190 (Pdyn)
  09165 Substance dependence
   05030 Cocaine addiction
    29190 (Pdyn)
   05031 Amphetamine addiction
    29190 (Pdyn)
   05034 Alcoholism
    29190 (Pdyn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29190 (Pdyn)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   29190 (Pdyn)
SSDB
Motif
Pfam: Opiods_neuropep
Other DBs
NCBI-GeneID: 29190
NCBI-ProteinID: NP_062247
RGD: 62054
Ensembl: ENSRNOG00000026036
UniProt: F1M7S3
Position
3q36
AA seq 248 aa
MAWSRLMLAACLLVIPSEVTADCLSLCSLCAVRTQDGPHPINPLICSLECQDLVPPSEEW
ETCRGFWSFLTLTASGLHGKDDLENEVALEEGYTELTKLLEPLLKELEKGQLLTSVSEEK
LRGLSSRFGNGRESELLGTDLMNDEAAQAGTLHFNEEDLRKQAKRYGGFLRKYPKRSSEM
AGDEDRGQDGDQVGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQENPN
TYSEDLDV
NT seq 747 nt   +upstreamnt  +downstreamnt
atggcgtggtccaggctgatgctggcagcttgcctccttgtgatcccctctgaggttaca
gcagactgcctgtccttgtgttccctgtgtgcagtgaggacgcaggatgggccccatccc
atcaaccccctgatttgctccctggagtgccaggacctggtgccgccctcggaggagtgg
gagacatgccggggcttttggtcttttctcaccctgactgcctctgggctccatggcaag
gatgacttggagaatgaggttgctttggaagaaggctacacggaactgaccaagctcttg
gagcccctcctgaaggagctggagaaaggccaactccttaccagcgtctcagaggaaaag
ctcaggggtctctccagcaggtttggcaacggaagagaatctgagctactgggcactgac
ctgatgaatgatgaagccgcacaggctggcacgctccatttcaacgaggaggacttgaga
aaacaggccaaacgctatggcggctttttgcgcaaataccccaagaggagctccgagatg
gctggggacgaggacaggggccaggatggggatcaggtagggcatgaggacctgtacaaa
cgctatgggggcttcctgcggcgcattcgccccaagcttaagtgggacaaccagaaacgc
tatggtggttttctgcggcgtcagttcaaggtggtgactcggtcccaggagaaccccaat
acctattccgaagatttagatgtttga

DBGET integrated database retrieval system