KEGG   Rattus norvegicus (rat): 291905Help
Entry
291905            CDS       T01003                                 

Gene name
Fto, RGD1305121
Definition
(RefSeq) FTO, alpha-ketoglutarate dependent dioxygenase
  KO
K19469  mRNA N6-methyladenine demethylase [EC:1.14.11.53]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    291905 (Fto)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.53  mRNA N6-methyladenine demethylase
     291905 (Fto)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     291905 (Fto)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTO_NTD FTO_CTD
Motif
Other DBs
NCBI-GeneID: 291905
NCBI-ProteinID: NP_001034802
RGD: 1305121
Ensembl: ENSRNOG00000011728
UniProt: Q2A121 B4F7E0
Position
19p11
AA seq 502 aa AA seqDB search
MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLVFREAGSIPEE
LHKEVPEAFLTLHKHGCLFRDLVRIQGKDVLTPVSRILIGDPGCTYKYLNTRLFTVPWPV
KGCTINYTEAEIAAACQTFLKLNDYLQVETIQALEELAIKEKANEDAVPLCMAEFPRAGV
GPSCDDEVDLKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVA
VYSYSCEGSEDESDDESSFEGRDPDTWHVGFKISWDIETPGLTIPLHQGDCYFMLDDLNA
THQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVLNDSDNGDVSLKSFEPAV
LKQGEEIHNEVEFEWLRQFWFQGNRYKICTDWWCEPMTQLEGLWKKMESVTNAVLREVKR
EGLSVEQRSEILSAVLIPLTMRQNLRKEWHARCQARVVRTLPAQQKPDCRPYWEKDDPSM
PLPFDLTDVVSEIRSQLLEARS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgtccagaccgcggaggaacgggagcgggaagctaagaaactgaggctcctc
gaggagcttgaagacacttggcttccttacctgacccccaaagatgacgagttctatcag
cagtggcagctgaaatatcctaaactggttttccgagaggctggcagcatacccgaggag
ctgcacaaagaggtccccgaggcctttctcacactgcacaagcatggctgcttgtttcgg
gacctggtgaggatccaaggcaaagacgtgctcaccccggtgtctcgcatcctcattggg
gaccccggctgcacctacaagtacttgaacaccaggctcttcaccgtgccctggccagtg
aagggctgcaccatcaattacacagaggccgagattgccgccgcatgtcagaccttcctc
aagctcaatgactacctacaggtcgagaccatccaggccttggaagaactggctatcaaa
gagaaggccaatgaagacgctgtgccgttgtgcatggcagagttccccagggctggcgtg
ggaccgtcctgcgatgatgaagtggaccttaagagcagagcagcctacaacgtgactttg
ctaaacttcatggatcctcagaaaatgccgtacttgaaagaggagccctatttcggcatg
gggaagatggcggtgagctggcaccatgacgagaacttggtggacaggtcagccgtggcg
gtgtacagctatagctgtgaaggctccgaggatgaaagcgatgacgagtccagcttcgaa
ggcagagatcccgatacgtggcatgttggttttaagatctcatgggacatcgagacgcca
ggcttgacaattcctcttcaccagggagactgctatttcatgctggatgacctcaatgcc
acccaccagcactgtgttttggctggctcacagcctcggtttagctccacccaccgcgtg
gcagagtgctcaacaggcaccttggattatatcttacaacgctgccagttggcactgcag
aatgttctcaatgactcggacaatggcgacgtctcgctgaagtccttcgagcctgcagtt
ctgaaacaaggagaagagatccacaacgaggtcgagtttgagtggctgaggcagttctgg
tttcaaggaaatcgatacaaaatttgcactgattggtggtgtgagcccatgactcagctg
gaggggctgtggaagaagatggagagtgtgacaaatgccgtgcttcgtgaagttaagaga
gaggggctctccgtggaacaaaggagtgaaattctgtctgccgtcctgatcccactcacc
atgcgccagaatctgaggaaagaatggcacgccaggtgccaggcccgagttgtccgaact
ctaccagcacagcagaaaccagactgccggccatattgggagaaggatgacccttctatg
cctctgccctttgacctcacagatgtggtctctgagatcagaagccagcttctggaagca
agatcctag

DBGET integrated database retrieval system