KEGG   Rattus norvegicus (rat): 291912Help
Entry
291912            CDS       T01003                                 

Gene name
Nod2, Card15
Definition
(RefSeq) nucleotide-binding oligomerization domain containing 2
  KO
K10165  nucleotide-binding oligomerization domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04668  TNF signaling pathway
rno05152  Tuberculosis
rno05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    291912 (Nod2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    291912 (Nod2)
 09160 Human Diseases
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    291912 (Nod2)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    291912 (Nod2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    291912 (Nod2)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   291912 (Nod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT CARD NLRC4_HD2 LRR_6 NOD2_WH AAA_22 AAA_29 AAA_16 AAA_25 AAA_30 G-alpha AAA_33 ABC_tran NB-ARC
Motif
Other DBs
NCBI-GeneID: 291912
NCBI-ProteinID: NP_001099642
RGD: 1306368
Ensembl: ENSRNOG00000014124
UniProt: D4A5W3
Position
19p11
AA seq 932 aa AA seqDB search
MCSQEDFQAQRSQLVALLVSGSLEGFESILDWLLSWDVLSREDYEGLSLPGQPLSHSARR
LLDTVCNKGVWGCQKLFEAVQEAQANSHTFELQGCWDVHSLHPTRDLQSHRPAIVRRLCS
HVEAILELARDEGFLSQYECEEIRLPIFTSSQRARRLLDLAAVKANGLAAFLLQHVRKLP
ASLSLPYEAAECQKFTAKLRTMVSAQSRFLSTYDGSENLCLEDIYTENTLELRTEVGTAG
ALQKSPATLGLEELFGTHGHLNKDADTILVVGEAGSGKSTLLQRLHLLWASGQNFREFLF
IFPFSCRQLQCMTKPLSLRTLLFEHCCWPDVGQDDVFQFLLDHPDRVLLTFDGLDEFKFR
FTDRERHCSPLDPTSVQTLLFNLLQGNLLKNACKVLTSRPDAVSALLRKFVRTECHLKGF
SEEGIKLYLRKHHREPGVADRLIHLIQATSALHGLCHLPVFSWMVSRCHRELLLQNRGFP
TTSTDMYLLILQHFLLHASPPDSFPLGLGPGLLQSRLSTLLHLGHLALQGLAMSCYVFSA
QQLQAAQVDSEDISLGFLVRAQSVVPGSKAPLEFLHITFQCFFAAFYLAVSADTSAASLK
HLFSCGRPGNSLLLRLLPNLCIQGSRVKGGQAALLQKAEPHNLQITAAFLAGLLSQQHRD
LLAACQVPERVLLQRQARARSCLAHSLREHFHSIPPAVPGETKSMHAMPGFIWLIRSLYE
MQEVQLAREAVRRLDIGHLKLTFCRVGPAECAALAFVLQHLQRPVALQLDHNSVGDVGVE
QLLPCLGVCTALYLRDNNISDRGARTLVECALRCEQLQKLALFNNKLTDGCASSVAKLLA
HKQNFLSLRVGNNHITAAGAEVLAQGLKSNTSLQFLGFWGNSVGDKGSQALAEVVADHQR
LKWLSLVGNNIGSVGAHALALMLEKNKSLEEL
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcacaggaagacttccaggcccagaggagccagctggtggcactgttggtctca
gggtccttggagggctttgagagcatcttagactggctgctgtcttgggatgtgctctcc
agggaggactatgagggcctcagcctccctgggcaacctctctcccattctgccaggcgt
ctgctggacacagtctgcaacaagggtgtttggggctgtcagaagctcttcgaagctgtg
caggaggcccaggccaacagtcacacctttgaactgcaagggtgctgggacgttcactcc
cttcatcccaccagagacctgcagagtcaccggccagcaattgtacggaggctctgcagc
catgtagaagccatattggagctggcaagggatgaggggtttctgagccagtacgaatgt
gaggagatcaggttgccaatcttcacatcatcccagagggcaagaagactgcttgatctc
gccgcagtgaaggcaaatggactggccgccttccttctacagcacgtcaggaaattacca
gcctcactgtctctgccttacgaggctgctgagtgtcagaagttcactgctaagctgagg
accatggtgtcagctcagtctcgcttcctcagtacttacgatgggtcggagaatctttgc
ctggaggatatctacacggagaacaccttagagctgcggacagaggtgggcacagcgggg
gccttgcagaagagccctgccaccctgggcctggaggaactctttggaacccacggccac
ctgaacaaagacgccgacactatactggtggtgggcgaagcgggcagcggcaagagcacc
cttctgcaacgtttgcacttgttgtgggcatcagggcagaacttccgagagttcctcttc
attttcccattcagctgccggcagctgcaatgcatgaccaaacctctgtccctgaggaca
ctgctctttgagcattgctgttggcctgatgtcggtcaggatgacgtcttccagttcctc
cttgaccatcctgaccgtgtcctgttaacctttgatggcttggatgagttcaagttccgg
ttcacagaccgggagcgccactgctctccgctcgaccccacgtcagtccagactctgctt
ttcaaccttcttcaggggaacctgctgaagaatgcctgcaaggtactgaccagccgtcca
gacgccgtgtcagcgctcctcagaaagttcgtccggacagagtgccaccttaagggcttc
tccgaagagggcatcaaactgtacctgagaaagcaccaccgggaacccggggtggcagac
cgcctcatccacctgatccaagctacctcagccctgcacggtttgtgccacctccctgtc
ttctcatggatggtgtccagatgtcaccgagagctgttgctacagaacaggggcttccca
acaaccagcacggacatgtacctcttgatcctacagcatttcctgctgcacgcctcccct
ccggactccttcccccttggtctgggacctggactcctccaaagccggctctccaccctc
ctgcaccttggccacctggctctccagggcctggccatgagctgctatgtgttctcagcc
cagcagctgcaggcagcacaggtggactctgaggatatttctcttggtttcctggtacgc
gcccaaagtgtggtgcccgggagcaaggcacccctggaattcttgcacattaccttccag
tgcttttttgccgcgttctacttggctgtcagtgctgacacatcggcggcctctctcaag
cacctcttcagctgcggccggccgggcaactcactgctgctaaggctgctgcccaacctg
tgtatccagggctccagagtcaagggcggccaagcagctctgctgcagaaggctgagccg
cacaacctgcagatcacagcagccttcctagcgggtctgttgtcccagcagcatcgggac
ctgttggctgcatgccaggtccctgagagggtgctgctccagcgtcaggcccgtgcccgc
tcctgcctggcacacagcctccgggagcacttccattccatcccgccggccgtgcccggt
gagaccaagagcatgcatgctatgcccggcttcatttggctcatccggagcctgtacgag
atgcaggaggtgcagttggcccgggaggctgtccgtcgcttggacattgggcacctgaag
ttgacgttttgcagggtgggccctgcagagtgcgctgccctggcctttgtgctgcagcat
ctgcagcggcctgtggccctgcagttggaccacaactccgttggcgatgtcggagtggaa
cagctgctgccatgcctcggcgtctgcacagctctgtacttgcgagataacaacatctcc
gatcgaggtgcccgcacgctggttgagtgtgctcttcgctgtgaacagctgcagaagcta
gctctcttcaacaacaaactcactgatggctgtgcctcctccgtggccaagctccttgca
cacaagcagaacttcctatctctgagggtggggaacaatcacatcactgctgctggggct
gaggtgctggcccagggactcaagagcaacacctccctgcagttcctggggttctggggc
aacagtgtaggtgataagggctcccaagccctggctgaagttgtggctgatcaccagagg
ctaaagtggctcagcctggtaggaaacaacattggcagcgtgggtgcccacgccctagcc
ctgatgctggagaagaacaagtcactagaggagctctga

DBGET integrated database retrieval system