KEGG   Rattus norvegicus (rat): 29194Help
Entry
29194             CDS       T01003                                 

Gene name
Chka, CK-R, Chk
Definition
(RefSeq) choline kinase alpha
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
rno05231  Choline metabolism in cancer
Module
rno_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
rno_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    29194 (Chka)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    29194 (Chka)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     29194 (Chka)
    2.7.1.82  ethanolamine kinase
     29194 (Chka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo Helo_like_N
Motif
Other DBs
NCBI-GeneID: 29194
NCBI-ProteinID: NP_058823
RGD: 61944
Ensembl: ENSRNOG00000016791
UniProt: Q01134 Q66HK1
Position
1q43
AA seq 435 aa AA seqDB search
MKTKFCTGGEAEPSPLGLLLSCGGSAAPTPGVGQQRDAAGELESKQLGGRSQPLALPPPP
PPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLREDQFHISVIRGGLSNML
FQCSLPDSIASVGDEPRKVLLRLYGAILKMGAEAMVLESVMFAILAERSLGPKLYGIFPQ
GRLEQFIPSRRLDTEELCLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKYLNQVLR
LKFSREARVQQLHKFLSYNLPLELENLRSLLQYTRSPVVFCHNDCQEGNILLLEGQENSE
KQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFRANIQKYPTRKQQLHFISSY
LTTFQNDFESLSSEEQSATKEDMLLEVNRFALASHFLWGLWSIVQAKISSIEFGYMEYAQ
ARFDAYFDQKRKLGV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttctgcaccgggggcgaggccgagccgtccccgcttgggctgctgctg
agctgcggtggcagcgctgccccgacgcccggcgtagggcagcagcgcgatgccgcaggc
gagctggagtccaagcagcttggtggccggtcccaacctctcgcgctgccgccgccacca
ccgccgcccctgccgctgcccccgccgccatcaccgccgctagcggacgaacaacccgag
ccccggacgcggcgcagggcctacctgtggtgcaaggaattcctgcccggagcctggagg
ggccttcgcgaggaccagttccacatcagtgtcatcaggggtggtctcagtaacatgctg
ttccagtgttccttgccagactccatagccagtgttggtgatgaacctcggaaagtgctc
ttgcgactgtatggggcaatcttaaagatgggggctgaagcaatggttctggagagtgtt
atgtttgccattcttgcagagaggtcacttgggccaaaactctatggcatctttccgcaa
ggccgactggagcagtttatcccgagccggcgattggacactgaagaattatgtttacca
gatatttctgcagaaatagctgaaaaaatggccacatttcatggtatgaaaatgccattc
aataaggaaccaaaatggctttttggaacaatggaaaaatacctgaatcaagtactaaga
cttaaattcagcagggaggccagagttcaacaactgcacaagttcctctcttacaatctg
cctctcgagcttgagaacctgaggtcattgctgcagtatactagatccccagttgtgttt
tgtcataatgactgtcaagaaggtaatatcttattgttggaaggccaagagaattctgaa
aagcagaagttgatgctcattgactttgaatacagcagttacaattacaggggatttgac
attggaaatcatttctgtgaatggatgtatgattatacctatgaaaagtatcctttcttc
agagcaaacattcagaagtatcctacccgaaaacaacagctccattttatttcaagttac
ttgactacattccaaaatgattttgaaagcctcagcagtgaagagcagtctgctacaaaa
gaagacatgttgcttgaagtcaacagatttgcccttgcctctcatttcctctggggactt
tggtccattgtacaggccaagatctcatccattgaatttgggtacatggaatatgcccaa
gccaggttcgatgcctactttgaccagaagaggaagcttggtgtgtga

DBGET integrated database retrieval system