KEGG   Rattus norvegicus (rat): 291942
Entry
291942            CDS       T01003                                 

Gene name
Slc10a7
Definition
(RefSeq) sodium/bile acid cotransporter 7
  KO
K14347  solute carrier family 10 (sodium/bile acid cotransporter), member 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    291942 (Slc10a7)
   04147 Exosome [BR:rno04147]
    291942 (Slc10a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   291942 (Slc10a7)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   291942 (Slc10a7)
SSDB
Motif
Pfam: SBF_like SBF
Other DBs
NCBI-GeneID: 291942
NCBI-ProteinID: NP_001010948
RGD: 1564388
Ensembl: ENSRNOG00000011991
UniProt: Q5PT50
Position
19
AA seq 340 aa
MRLLERVRKEWFMVGIVVAIGAAKLEPSVGVNGGPLKPEITVSYIAVATIFFNSGLSLKT
EELTSALVHLKLHLFIQVFTLAFFPTTIWLFLQLLSVTSINEWLLKGLQTVGCMPPPVSS
AVILTKAVGGNEAAAIFNSAFGSFLGIVVTPVLLLLFLGSSSSVPFTSIFSQLFMTVVVP
LVIGQIVRRYIKDWLERKKPPFGVVSSSVLLMIIYTTFCDTFSNPNIDLDKFSLILILFI
IVSIQLSFMLLTFVFSTRNNSGFTPADTVAIIFCSTHKSLTLGIPMLKIVFAGHEHLSLI
SLPLLIYHPAQILLGSVLVPTIKSWMVSRQKGVKLTRPTV
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaggctgctggagagggtgaggaaagaatggttcatggtcgggatagtggtggcgatc
ggcgccgctaagctggagccgtcggtcggagtgaacgggggaccactgaagccagagata
actgtgtcctacattgctgttgcaacgatattcttcaacagtggactgtcattgaaaaca
gaggagctgaccagcgcactggtgcacttgaagctgcatctcttcatccaggtcttcacg
cttgccttcttcccaacaacaatatggctctttcttcagctcctatcagtcacgtccatc
aacgagtggcttttaaaaggtttgcagacagtaggctgcatgcctccccctgtgtcttct
gctgtgattctaaccaaggcagtcggaggaaatgaggcagctgcaatatttaattcagca
tttggaagttttttgggcattgttgtgactccagtgctcctgctgcttttcctcggctca
tcctcttccgtgccttttacatcgattttctctcagctctttatgacggtggtggttcct
cttgttatcggacagatcgtccgaagatacatcaaggactggctcgaaaggaagaaaccg
cctttcggcgtggtcagcagcagcgtgcttctcatgatcatctacaccaccttctgtgac
actttctccaacccaaacattgacctggacaaattcagcctcatcctcatactgttcata
atagtctccattcaactgagcttcatgcttctgactttcgtcttctccacacggaataac
tcggggttcacaccagcagacacagtggctatcatcttctgctctacacacaagtccctc
accttggggatcccgatgctgaagatagtgtttgccggccatgagcatctctcgctgata
tccctgcccttgcttatctaccacccggctcagatcctcctgggaagtgtgttggtgcca
actataaagtcttggatggtgtcgaggcagaagggagtgaagctgacgaggccaacagtg
tga

DBGET integrated database retrieval system