KEGG   Rattus norvegicus (rat): 291946Help
Entry
291946            CDS       T01003                                 

Gene name
Tmem184c, Tmem34
Definition
(RefSeq) transmembrane protein 184C
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Solute_trans_a
Motif
Other DBs
NCBI-GeneID: 291946
NCBI-ProteinID: NP_847900
RGD: 727852
Ensembl: ENSRNOG00000012860
UniProt: Q810F5
Position
19q11
AA seq 503 aa AA seqDB search
MPCACNRNNWRKWIRPLLILLYALAILVTVPVCIWEFQKLKVGIHTKVWFIAGIFLLLTI
PVSMCGILQHLVHYTQPELQKPIIRILWMVPIYSLDSWVALKYPKIAIYVDTWRECYEAY
VIYNFMIFLTNYLTIRFPNLMLHLEAKDQQNHLPPLCCCPPWAMGEMLLFRCKLGVLQYT
VVRPITTVTSLVCEILGVYDEGNFSFSNAWTYLVILNNLSQLFAMYCLLLFYKVLKEELS
PIQPVGKFLCVKLVVFVSFWQAVLIALLVKVGVISEKRTWEWQSAEAVATGLQDFIICIE
MFFAAIAHHYTFSYKPYVHEAEEGPCFDSFLAMWDVSDIREDISEQVRRVGRTMRGYPKK
KCFPGDPDHNEHSSLLSASSQDSSKPSSPVGLYQGFGQTITSQSPISIANLYEEILNEIP
EEQQRLYSGQDITMDIPEEQPRHDTGQDVVHLPYRQELPYKNHYQDHIQTVTSRYLLSSP
KPSDDIVIDFSDSPEGSDSSTDS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcgcatgtaatcggaataactggaggaaatggattcgacctctgttgatactc
ctttatgcgttggccatcctggtaaccgtacctgtttgcatctgggaatttcaaaaatta
aaggttggtattcacacaaaagtgtggtttattgctggaatatttctacttttgacgata
cctgtatccatgtgtggaattcttcaacatctagtgcattatacccaacccgagctgcag
aaacctataataaggatcctttggatggtcccaatctacagtttggatagttgggtggct
ttgaaatatcccaaaattgcaatatacgtggatacatggagagaatgttatgaagcttac
gtaatctataactttatgatattccttaccaactacctgacaatccgatttccaaacttg
atgttacatctggaagctaaagatcaacaaaaccatctccctccattatgctgctgtcca
ccatgggcgatgggagaaatgctgctcttcaggtgcaagctaggagtgctgcagtacact
gtcgtcagaccgatcaccaccgtcacctccttagtttgtgaaattctcggagtatatgat
gagggaaacttcagtttctccaatgcgtggacgtaccttgttatattaaacaatttgtca
caactgtttgccatgtactgcctactgctgttctacaaagtcttaaaggaagagctcagc
cctatacaacctgttggcaagtttctctgtgtgaaactcgtcgtctttgtctccttttgg
caagcagtacttattgctttgttggttaaagtgggcgttatttcagaaaagcgtacctgg
gaatggcaaagcgccgaagctgtggccacaggcttgcaggatttcataatctgcatcgaa
atgttctttgcggcaattgcccatcattatacgttctcctataaaccctatgtgcatgaa
gcagaggaaggcccctgctttgactccttcctcgctatgtgggatgtgtctgatatcaga
gaagatatttctgaacaagtaaggcgtgtcgggaggacaatgcgaggttacccgaagaag
aaatgtttccctggagacccggatcataatgaacactccagcctactctcagcgtcttca
caagactcttccaagccgtcctcaccggtgggcctgtaccagggatttggacagaccatc
acttcacagagccccatttcaatagccaacctatatgaagagatcttgaatgaaatccca
gaagagcaacaaaggctctactcaggccaggatatcactatggacatcccagaagagcag
ccgcggcatgatacaggccaggatgtcgttcaccttccttatagacaggagcttccttat
aaaaaccactatcaagaccacatacaaacagtcacttcacggtatttactttcttcacca
aagccatctgacgatattgtgattgacttctcagactctccagagggttcggactcatcc
acagactcatga

DBGET integrated database retrieval system