KEGG   Rattus norvegicus (rat): 291958
Entry
291958            CDS       T01003                                 

Gene name
B3gnt9
Definition
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
  KO
K18705  beta-1,3-N-acetylglucosaminyltransferase 9 [EC:2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    291958 (B3gnt9)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     291958 (B3gnt9)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   291958 (B3gnt9)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 291958
NCBI-ProteinID: XP_008770778
RGD: 1310170
Ensembl: ENSRNOG00000053895
UniProt: A0A0G2K1Q3
Position
19
AA seq 398 aa
MRRRPRLCRDAWLTLLLSAALGLLLYAQRDGVSPTTRAPPARGRQLPRPTPGRRALELPN
TAHAAPPAYEGETPVPPTPTDPFDFRRYLRAKDQRRFPLLINQPRKCHSDGASGGSLDLL
IAVKSVAADFERREAVRQTWGAEGRVQGALVRRVFLLGVPKGAGSGGAGTRTHWRALLEA
ESRAYADILLWAFEDTFFNLTLKEIHFLSWASAFCPDVHFVFKGDADVFVHVRNLLQFLE
PRDPAQDLLAGDVIVQARPIRARASKYFIPQAVYGLPVYPAYAGGGGFVLSGATLHRLAH
ACTQVELFPIDDVFLGMCLQRLRLTPEPHPAFRTFGISQPSAAPHLRTFDPCFYRELVVV
HGLSAADIWLMWRLLHGPQGPVCAHPQPVATGPFQWNS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaggaggaggccgcgcctttgccgggatgcgtggcttacgctgttgctcagcgccgcc
ctcggactcctgctctatgcgcagcgcgacggggtatcccccacgaccagagcaccacca
gcgcgaggacgacagctcccgcggcctactcctggtcgccgagcactggagctccccaac
accgcccacgcggccccgccagcctacgaaggggagaccccggtgccacccacacctacg
gacccctttgacttccgcaggtatctgcgcgccaaggaccaacggcgctttccgctacta
attaaccagccgcgcaaatgccacagcgacggcgcatctggcggctcgctcgacttgctc
atcgcagtcaagtctgtggccgccgacttcgagcggcgggaagccgttcgccaaacttgg
ggcgccgagggtcgcgtgcagggggcactcgtgcgccgagtgttcttattaggcgtgcct
aagggggcgggctccggcggggcaggcacgcggacgcactggcgcgccctactggaagct
gagagccgagcttatgcagacatcctgctctgggctttcgaagacacctttttcaatcta
acgctcaaggagattcactttctatcttgggcctcagcattctgtccggatgtacacttt
gtttttaagggcgatgcagatgtgttcgtgcacgtgaggaacctgctgcagtttctggag
ccgcgggatccagcccaggatcttcttgcaggtgatgtgattgtgcaggcaaggccgatc
cgagctagagccagcaagtacttcattccccaggctgtgtatggactgccggtttaccct
gcctacgcaggtggtggtgggtttgttctttcgggagccacactccatcgcctagctcat
gcctgcacgcaagttgagctctttcccatagatgatgtctttctgggcatgtgtttgcag
cgcttgcggctcacacctgagcctcatccagcatttcgcacctttggcatctcccagcct
tcggctgcaccacatcttcgaaccttcgacccctgtttctaccgagaactggtggtagtg
cacgggctatctgcagctgacatttggcttatgtggcgcttgctgcatgggcctcagggg
ccagtctgtgcacacccacagcctgtggcaacaggtcccttccaatggaattcctag

DBGET integrated database retrieval system