KEGG   Rattus norvegicus (rat): 291962
Entry
291962            CDS       T01003                                 

Gene name
Elmo3
Definition
(RefSeq) engulfment and cell motility 3
  KO
K19241  engulfment and cell motility protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    291962 (Elmo3)
SSDB
Motif
Pfam: DUF3361 ELMO_CED12 PH_12
Other DBs
NCBI-GeneID: 291962
NCBI-ProteinID: NP_001025199
RGD: 1304734
Ensembl: ENSRNOG00000015800
UniProt: Q499U2
Position
19q11
AA seq 720 aa
MAPPRNVVKIAVQMSDAIPQLIQLDQAKPLATVLKEVCDTWSLTHPEHYALQFADGHRKY
ITENNRSEIKNGSILCLSTAPDLKAQQLLSRLQNASREGCCEVLRNLVPLASDMTFAQEV
ISRDGLQKLSTIIENGDDLGEMLALGLRAFLELMEHGVVSWETLSISFVRKVVSYVNMNL
MDASVQPLALRLLESVTLSSPTLGQLVKSEVPLDRLLVHLQVMNQQLQTKAMALLTALLQ
GASPAERKDMLDCLWKKNLRQFIYKNIIHSAAPMGDEMAHHLYVLQALTLGLLEPRMRTP
LDPYSQEQREQLQALRQAAFEPDGESLGTGLSADRRRSLCVREFRKLGFSNSSPAQDLER
VPPGLLALDNMLYFSRHAPSAYSRFVLENSSREDKHECPFARSSIQLTVLLCELLHVGEP
CSETAQDFSPMFFSQDHSFHELFCVAIQLLNKTWKEMRATQEDFDKVMQVVREQLARTLA
LKPTSLELFRTKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKLKPELMGLIRQQRL
LRLCEGMLFRKISSRRRQDKLWFCCLSPNHKVLQYGDVEEGANPPTLESLTEQLPVADIR
ALLMGKDCPHVREKGSGKQNKDLYELAFSISYDHGEEEAYLNFIAPSKRDFYLWTDGLSA
LLGSTMGSEQTRLDLEQLLTMETKLRLLELENVPIPEHPPPVPPPPTNFNFCYDYSMTEP
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcgcccccgcggaatgtggtgaagattgccgttcagatgtctgacgccatcccacag
cttatccagctagaccaggcaaagcccctggccactgttctgaaggaggtgtgtgacacg
tggagcctgactcatccggagcactatgcccttcagtttgctgatgggcacaggaaatac
atcacagagaataaccgctcggagatcaagaatggaagcatcctgtgcctcagtactgcc
ccagatctgaaggcccagcagctactgagtaggctgcagaatgcgagtcgtgaagggtgc
tgtgaagtcctgagaaacctggtcccgctggcctcagacatgacctttgcccaggaggtc
atcagtcgtgatgggcttcagaaattaagcaccatcattgaaaatggggatgacctaggg
gagatgctggcccttgggctaagggctttcctggagctcatggaacacggagtagtgtct
tgggagacactcagcatttcctttgtcaggaaggtggtatcttatgtgaacatgaacttg
atggatgcctctgtgcagcccctggccctcaggctactggagagtgtgaccctgagcagc
cctaccctgggccagctggtgaagagtgaggtgccactagacaggctgctagtgcacctg
caggtaatgaaccagcagctgcaaaccaaggctatggcactgctgacagccctgctgcag
ggggccagccctgctgagcgtaaggacatgcttgactgcctatggaagaagaatcttcgc
cagttcatctacaagaacatcatccacagtgcagcacccatgggtgacgagatggctcat
cacttgtatgtgctgcaggctctaacactggggctgctggagccacgtatgcggacaccc
cttgatccctacagccaggagcagcgggagcagctacaggccctgcgccaggcagccttt
gaaccagacggggagtccttgggcacaggcctgagtgctgaccgccgccggtctctctgt
gtccgagagttccgcaagctaggcttctccaatagcagcccggcccaggacctggaacgt
gtgccccctggcctactggccctggacaacatgctctacttctccagacatgcgcctagt
gcatacagtcggttcgtgttggagaacagtagccgagaggacaagcatgaatgccccttt
gcccggagcagcattcagctgacagtgttgctgtgtgagctgctccatgttggggagcct
tgctccgagaccgcccaggacttctcacccatgttcttcagccaagaccacagtttccat
gagctcttttgtgtggctatccagctgctgaataagacctggaaggaaatgcgggcaaca
caggaggattttgacaaggtaatgcaggtggttcgggaacagctagcccgtaccctggct
ctgaagcccacctctctggagctctttcgaaccaaagtaaatgccctcacctatggggaa
gtgttgaggctgcgacagacagagcggctgcaccaagagggcacattggcccctcctatc
ttggagctccgagagaagctgaagccagagctcatgggtttaatccgccagcagcgtttg
ctccgactctgtgagggaatgctcttccgcaagatcagcagccggagacgccaggacaag
ctatggttttgctgtttatcccccaaccataaagtactgcagtatggcgatgtggaggag
ggcgccaaccctcccaccttagaaagcctaactgaacaactccctgtggctgacatcagg
gcactcctaatgggcaaggactgcccccatgtccgggagaagggctctgggaagcagaac
aaggacctctatgagttggccttctccatcagctatgaccatggggaggaagaagcatac
ctcaacttcattgccccctccaaacgggatttctacctgtggacagatggactgagtgcc
ctgctgggcagtactatggggagtgaacagactcggctagacctggagcagctgctcact
atggagaccaagttgcggttgttggaactggagaatgtgcccattcctgagcatcctccc
ccagtacccccacctcctaccaactttaacttctgctatgactacagcatgactgagcct
tga

DBGET integrated database retrieval system