KEGG   Rattus norvegicus (rat): 291964Help
Entry
291964            CDS       T01003                                 

Gene name
Fhod1
Definition
(RefSeq) formin homology 2 domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Formin_GBD_N Drf_FH3
Motif
Other DBs
NCBI-GeneID: 291964
NCBI-ProteinID: NP_001178529
RGD: 1589776
Ensembl: ENSRNOG00000054625
UniProt: A0A0G2JZ38
Position
19q11-q12
AA seq 1158 aa AA seqDB search
MAGEEERGDGDPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLSAQIPALHR
LLGAPLKLEDCALQVSPSGYYLDPELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRV
NAILEKLYGSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYI
LRALGQLMLFVDGMLGVVAHSETVQWLYTLCASLSRLVVKTALKLLLVFVEYSENNAPLF
IQAVNAVASNTGTLPWANLVSILEEKNGVDPELLVYTVTLINKTLAALPDQDSFYDVTDA
FEQQGMEALVQRLLGTAGTDVDLRTQLTLYESALRLEDGDMEEAAAAAAAGGRRERRKPS
SEEGKRSRRSLEGGGCPVRTPEPGPTGSASPVGSASFTDSTSPTSSAFSPTGPASGLHTS
VNLFPTISVGPSVDTSCERSVYKARFLENVAAAETEKQAALAQGRAETLAGATVDETDES
SGTRELWDSSEPASAPRPPQSPVSPIVLRTQRSLEPEPKEPVSPRSPKTEPVQELPTHVP
KLCIGDLDFSDLGEDEDQDTLNVESVEAGKASLVLSLPPPPPPPPPPPIMGSCLPPPPLA
APFPHSALDGPRHPTKRKTVKLFWRELKPTGSPGCSRSRFGPCPTLWASLEPVSVDTARL
EHLFESRAKDVLPTKKAGEGRRTMTIVLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFA
VSKDGIEKLLTMMPTEEERQKIEEAQLANPDVPLGPAENFLMTLASIGGLAARLQLWAFK
LDYESMEREIAEPLFDLKVGMEQLVHNATFRCILATLLAVGNFLNGSQSSGFELSYLEKV
SEVKDTVRRQSLLYHLCSLVLQTRPDSSDLYSEIPALTRCAKVDFEQLTENLGQLECRSQ
AAEDSLRSLAKHELSPALRARLTHFLAQCTRRVAMLRVVHRRVCNRFHAFLLYLGYTAQA
AREVRIMQFCHTLREFALEYRTCRERVLQQQQKRATYRERNKTRGRMITETEKFSGVAGE
VPSNLSVPVAVGSGPGRGDADNHASMKSLLTSRPEDATHSRRSRGMVQSSSPVTHTTVGP
FTASPEETAASGLPSDTSDEIMDLLVQSVTKSSPRALAARERKRSRGNRKSLRRTLKSGL
GDDLVQALGLSKAPGLEV
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgaggaagagcgcggggatggggacccagtatcagtggtgactgtgagagtg
cagtacctggaagacaccgaccctttcgcttgtgccaacttcccggaaccacgccgggcc
cccacctgcagcttggacggggctctgcccctgagtgcgcagatccctgctctgcaccga
ctcctgggagcgcctctcaagctggaggactgtgcgttgcaagtgtcgccctctggatac
tacctggacccggagctgtccctagaagaacagcgggagatgctggagggcttctatgaa
gagatcagcaaagggcggaagcccacattgatcctgcggacccagctctctgtgagggtc
aatgctatcttggaaaagctgtatggctccagtggccccgagctccgccgatccctcttt
tcattaaagcagatattccaggaagacaaggacctggtgcctgaatttgtacactcagag
gggttgagttgcctgatccgcgtgggtgctgctgctgaccacaactatcagagctacatc
cttcgagccctgggccagctgatgctttttgtggatgggatgctaggggtggtggcgcac
agtgagaccgtgcaatggctgtatacactgtgtgcaagcctgtcccgcttggtggtaaag
acagccctgaagctgctgctggtgtttgtggagtattctgagaacaatgcaccgctcttc
atccaggcagtcaacgctgtagccagcaacaccggtactcttccctgggccaacttggtg
tccatcctggaggagaagaatggagttgatccagagctgttggtgtacacggtcactctc
attaacaagacactggcggcgctcccagaccaggactccttctatgatgtgacagatgct
tttgagcagcagggcatggaagcgctggtccaacgtctcttgggcactgctggcactgat
gttgacctgcgaacacagctaacgctctatgagagcgcccttcggttagaggatggagat
atggaagaggctgcagctgctgcagctgcaggtggccgacgagagcgacggaagccatcc
tcagaggagggcaaaaggagccgaagatcactagaaggtggaggctgtcctgtgcgtacc
ccagaacctggcccaacaggctctgcctctccagtaggctccgcctccttcactgactcc
acctcgcctacaagttcggccttcagccctactggcccagcctctggtcttcatacctca
gtgaacctctttcctaccatttctgtggggccctcagtggacacttcctgtgagagaagt
gtctacaaagcccggtttctggagaatgtggcagcagcagagacagagaagcaggctgct
ctggcccaaggccgagcagagacgctggcaggggcaacagtggatgagacagatgagtca
tcaggcaccagggaactgtgggactcttcagagccagcctctgcacccagaccacctcag
agccctgtttccccaatcgtgctgcggacccagagaagtcttgagcctgagcccaaggag
ccagtgtcaccacgaagccctaagactgagcctgtccaggagcttcctactcacgtaccc
aagctctgcattggagacttggacttctcagatctaggggaggatgaagaccaggacaca
ttgaatgtggaatctgtggaggctggaaaagcatccctggtcctgtcacttccaccacca
cctccacccccacctcccccacccatcatgggctcctgcctaccacctccacccctggct
gctccttttccccactcagcccttgacggcccaaggcaccccaccaaaaggaagactgta
aaacttttctggcgggaactaaagccgactgggagccctgggtgttctagaagccgcttt
gggccttgtcctaccttgtgggcctctctggaacctgtctcggtggacacagcccggctg
gaacacctatttgagtcccgagccaaggatgtgctacccaccaagaaagctggtgagggc
cgccggacaatgaccatagttctggaccccaagcgcagcaatgccatcaacattggccta
accactctgccacctgtgcatgtcatcaaggctgctctgctcaactttgatgaatttgct
gtcagcaaggatggtattgagaaactgctgaccatgatgcccacggaggaagagcgacag
aagattgaggaagcccagctggccaaccctgatgtgcccctcggcccagctgagaatttc
ctgatgactcttgcttccattggaggcctggccgcgcgcctgcaactctgggctttcaag
ctggactatgaaagcatggagcgggaaattgcagagccactgtttgatctgaaagtgggc
atggaacagttggtgcacaatgccaccttccgttgcattctggctacccttttggctgtg
ggcaacttcctcaatggctcccagagcagtggctttgagctgagctacctggagaaggtg
tcagaagtaaaggacacagtgcgccggcagtcactgctgtatcatctctgttccctggtg
ctccagacccgacctgattcctctgacctctactcagaaattcctgccctcacccgctgt
gccaaggtggactttgagcagctgactgagaacctagggcagctggagtgccggagccag
gctgctgaggacagcctccggagcttggcaaagcatgagctatccccagctctgcgtgcc
cgccttacccacttcctggcccaatgtacccgccgagtagccatgctaagagtagtacac
cgtcgagtctgcaacaggttccacgccttccttctctacttgggctacaccgcacaggca
gcaagggaagtacgcatcatgcagttctgtcacacgctcagagagtttgcacttgagtat
cggacttgtcgggagcgggtactgcagcagcagcagaaacgggctacataccgcgaacgc
aacaagacccggggtcgcatgattactgagacagagaagttctcgggtgtggctggggag
gtccccagtaacctgtctgtcccagtggctgtgggcagcgggccaggtcggggtgatgct
gacaatcatgccagtatgaagagtttgcttaccagcaggccagaagacgccacacacagc
cgacgtagcagaggtatggtccagagtagttcccccgtcacacacacaacagtagggccc
ttcactgcatcccctgaggagactgcagcctctggtttacctagtgacacatcagatgag
ataatggacctgctggtgcagtcagtcaccaagagcagtcctagagccttggctgctcgg
gagaggaagcgctctcgtggcaaccggaagtccttgaggcggacattgaagagtggactt
ggagatgacctggtgcaggcactgggactaagcaaagctcctggcctagaggtgtaa

DBGET integrated database retrieval system