KEGG   Rattus norvegicus (rat): 291965Help
Entry
291965            CDS       T01003                                 

Gene name
Kctd19, RGD1561326
Definition
(RefSeq) potassium channel tetramerization domain containing 19
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BTB_2
Motif
Other DBs
NCBI-GeneID: 291965
NCBI-ProteinID: NP_001292128
RGD: 1561326
Ensembl: ENSRNOG00000016760
UniProt: F1LYX1
Position
19q12
AA seq 927 aa AA seqDB search
MEEPGMPHESAEDLFHFNVGGWHFSVPRSKLAQFPDSLLWKEALALTSSESQRLFIDRDG
STFRHVHYYLYTSKLSFSSCAELNLLYEQALGLQLMPLLQTLDNLKEGKHHLRVRPADIP
VAERASLNYWRTWKCISKPSEFPIKSPAFTGLHDKAPLGLMDTPLLDTEEEVHYCFLPLD
LVTKYPSLVTEDNLLWLAETVALIECECSEFRFIVNFLRSHKILLPDNFSNIDVLEAEVE
ILEIPELTEAVRLYRMNIGGSSRTSCPPLSPGKGGRIASLESVKPLYMMALGLLVKYPDS
ALGQLRIESTLDGSRLYITGNGVLFQHVRNWLGTCRLPLTETISEVYELCAFLDKRDITY
EPMKVALKTHLEPRTLPPMDMLNEEWTAEVTIYSPQQIIKVYVGSHWYATTLQTLMKYPE
LLSNTQRVYWITYGQTLLIHGDGQMFRHILNFLRLGKLFLPSEFKEWPLFCQEVEEYHIP
ALSEALAQCDAYKSWTQEKESENEEAFPIRKLHVVTEGTGPMVEFSRDAKETTACMPMDF
QECSDRTPWNKAKGNLARSSQMEEAEQYTRTIQVSLCRNAKRGGNPGTYSHCSGLCANPR
HWGGHSESPPKKKCTTINLTQKSDAKDPPVTPMQKLISLVREWDMVNSKQWEFQPLTASR
SSSLEEESLHVPSGSEAASQPGTSATWKAHSIPSEKDTGPQTGAGAGMRDKPPEPTFKPY
FPTKRAVTLKDWGKQRPKERENPAPEQPLPNVNGTDNPGAILKVTHPPVVGSDGSCMFFE
DSIIYTTQMDNIKHTPLTASPQPREVTFLSFSLSWEEMFYAQKCHRFLTDIILDSIRQKD
PKAITAKVVSLAYRLWTLNISPKQFVVDLLAITGFKDDRHTQERLYSWVELTLPFARKYG
RCVDLLIQRGLSRSVSYSVLGKYLQEG
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcctggcatgccccatgagtcagcagaggatttgtttcacttcaatgtcggg
ggctggcatttctcagttcccagaagcaaacttgctcaattcccagactcgctgttgtgg
aaagaggccttggccttgacctcttcggaaagtcagcggctattcattgacagagacggt
tccacattccggcatgtgcactattacctctacacctccaagctctccttctccagctgt
gcagaactgaacttgctctatgagcaagcactgggtttgcagctgatgccgttgcttcag
accctagataatctgaaggaagggaaacaccacctccgtgtgcggcctgccgacattcct
gttgctgagcgagcttccctgaactactggcgaacatggaagtgtatcagcaaaccctcg
gagtttccaataaaaagccctgccttcacaggtcttcatgataaggcccctttggggctc
atggacacaccgctgctggacacagaagaggaagtgcattactgcttcttacccctagac
ttggtgaccaagtacccaagcctagtgactgaagacaacctactgtggttggctgaaact
gtggccctgatcgagtgcgagtgtagcgagttccgcttcattgtgaattttctacgctca
cacaagattttgctaccagataacttctccaacattgatgtgttagaagcagaagttgaa
attctggaaatccctgagcttacagaagctgtacggctataccggatgaatattggtggc
tcttcccggacctcctgtccacctctaagtcctggaaaggggggtcgtatagccagtctg
gagtctgtgaaaccactgtacatgatggccctgggcctactggtcaagtatccagactct
gcactgggacagcttcgcattgagagcacactggatggaagcagattatacatcacaggg
aatggggtccttttccagcatgtcaggaactggctaggcacttgtcggctgcccctgact
gagaccatctctgaggtgtatgagctttgtgcctttctggacaagagggacatcacctat
gagccaatgaaagtggctctgaagactcatctagagccgaggactttgccacccatggat
atgctcaatgaggagtggacagcagaggtcactatatactcaccacaacagatcatcaag
gtttatgttggaagccattggtatgcaaccaccctgcagaccctgatgaagtacccagaa
ctgctatccaacactcagagagtatactggatcacctatggacagaccttgctcattcac
ggtgatggccaaatgttccgacacattctcaacttcctgagacttggaaaactgttttta
ccatcagaatttaaggaatggcctctcttctgccaggaagtggaggaatatcatattcca
gccctctcagaagccctggcacaatgtgacgcatacaagtcatggactcaggaaaaagaa
tctgaaaatgaagaagcttttcccattaggaagctgcatgtggtgacagaagggacaggg
ccaatggtagagttcagcagagatgcaaaggaaaccacagcctgcatgcctatggacttc
caagaatgcagcgacaggactccctggaacaaggctaaagggaacctggccaggtccagc
cagatggaagaggctgagcagtatacccggaccatccaggtctccctgtgcagaaatgcc
aagagggggggcaatcccggcacgtactcacactgttctggcttatgtgccaacccaaga
cactggggaggtcactctgaaagcccccccaagaagaagtgcaccactataaacctcaca
cagaaatctgatgccaaagaccctccagtcacccccatgcaaaaactcatatctttggta
agggagtgggacatggtcaactctaaacagtgggaattccagccactcacagcctccagg
agcagctctttggaggaggagagcctgcacgtcccctcaggaagtgaggctgcttctcaa
cctggtacctcagctacttggaaagctcattccataccctctgagaaggacactggtccc
cagactggagctggagctggaatgagagacaagcctccagagccaacctttaagccatac
ttccccacaaaaagagctgtcaccctaaaggactggggaaagcagaggcccaaagagaga
gaaaaccctgctcctgagcagcccctgcctaatgttaatgggacagacaacccaggggcc
atcctcaaagtgacgcacccccctgtggtggggagtgacggctcttgcatgttctttgaa
gacagcattatctacaccacccaaatggataacatcaagcatacaccactcacagctagc
ccccaacctcgagaagtgaccttcctgagcttctctctgtcctgggaagagatgttttat
gcacagaaatgtcaccgcttcctgactgacatcatcttggattccatcaggcaaaaagat
cccaaagccatcacagccaaggtggtgtccctggcctaccggctatggacgctgaacatc
agccccaagcagtttgtggtggatttgctggccatcactggcttcaaggatgaccggcac
actcaggagcgtctgtacagctgggtagagctcacactgcctttcgccagaaaatatggc
cgttgcgtggacctgctcatccagaggggactgtctaggtctgtctcttactcagtcctg
ggcaagtatttacaagagggctag

DBGET integrated database retrieval system