KEGG   Rattus norvegicus (rat): 291969
Entry
291969            CDS       T01003                                 

Gene name
Atp6v0d1
Definition
(RefSeq) ATPase H+ transporting V0 subunit D1
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    291969 (Atp6v0d1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    291969 (Atp6v0d1)
   04142 Lysosome
    291969 (Atp6v0d1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    291969 (Atp6v0d1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    291969 (Atp6v0d1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    291969 (Atp6v0d1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    291969 (Atp6v0d1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    291969 (Atp6v0d1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    291969 (Atp6v0d1)
SSDB
Motif
Pfam: vATP-synt_AC39 Nab2p_Zf1
Other DBs
NCBI-GeneID: 291969
NCBI-ProteinID: NP_001011927
RGD: 1306159
Ensembl: ENSRNOG00000017235
Vega: OTTRNOG00000002201
UniProt: Q5M7T6
Position
19q12
AA seq 351 aa
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcgttcttcccggagctttatttcaacgtggacaatggctacttggagggattagtg
cgcggcctgaaggccggggtgctcagccaggcggactacctcaacctggtgcagtgcgag
acgctcgaggacttgaaactgcacctgcagagtacagattatggcaacttcctggccaat
gaagcgtcacctctgacggtgtcagtcatcgatgacaagctcaaggagaagatggtagta
gagttccgccacatgagaaaccatgcctacgagccacttgccagcttcctggacttcatt
acttacagctacatgattgacaacgtgatcctgctcatcacgggcacactgcaccagcgt
tcaatagctgaacttgtgcccaagtgccatccgctaggcagttttgagcagatggaggct
gtgaacatcgcacagacacccgcagagctctacaatgccattctggtggacacgcccctg
gcggcttttttccaggactgcatctcagagcaggaccttgatgagatgaacattgagata
atccgaaacacgctttacaaggcttatctggagtccttctacaagttctgtactctgtta
gggggaaccacagctgatgccatgtgtcctatcctagagtttgaagcagatcgccgagct
ttcatcatcaccatcaactctttcggcacagagctttccaaggaggaccgtgccaagctc
tttccacactgtggccgactctaccctgagggcttggctcagctggctcgggctgatgac
tatgaacaggtcaagaatgtagctgattactacccggaatacaaactgctttttgagggt
gcaggtagcaatcctggagacaagaccctggaggaccgattctttgaacatgaggtgaag
ctgaacaagctggccttcctgaaccagttccactttggtgtcttttatgcctttgtgaag
cttaaggaacaggaatgtcgcaacattgtgtggattgctgagtgcattgcccagcgccat
cgcgccaagatcgacaactatatccccatcttctag

DBGET integrated database retrieval system