KEGG   Rattus norvegicus (rat): 29197
Entry
29197             CDS       T01003                                 

Gene name
Il18
Definition
(RefSeq) interleukin-18
  KO
K05482  interleukin 18
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05132  Salmonella infection
rno05134  Legionellosis
rno05135  Yersinia infection
rno05143  African trypanosomiasis
rno05144  Malaria
rno05152  Tuberculosis
rno05164  Influenza A
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29197 (Il18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29197 (Il18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    29197 (Il18)
   04623 Cytosolic DNA-sensing pathway
    29197 (Il18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    29197 (Il18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29197 (Il18)
   05135 Yersinia infection
    29197 (Il18)
   05134 Legionellosis
    29197 (Il18)
   05152 Tuberculosis
    29197 (Il18)
  09174 Infectious disease: parasitic
   05144 Malaria
    29197 (Il18)
   05143 African trypanosomiasis
    29197 (Il18)
  09163 Immune disease
   05323 Rheumatoid arthritis
    29197 (Il18)
   05321 Inflammatory bowel disease
    29197 (Il18)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29197 (Il18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29197 (Il18)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   29197 (Il18)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 29197
NCBI-ProteinID: NP_062038
RGD: 2889
Ensembl: ENSRNOG00000009848
UniProt: P97636
Position
8
AA seq 194 aa
MAAIPEEGSCVNFKEMMFIDNTLYLIPEDNGDLESDHFGRLHCTTAVMRSINDQVLFVDK
RNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFE
EMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENG
DKSVMFTLTNLHQS
NT seq 585 nt   +upstreamnt  +downstreamnt
atggctgccataccagaagaaggctcttgtgtcaacttcaaagaaatgatgtttattgac
aacacactttaccttatacctgaagataatggagacttggaatcagaccactttggcaga
cttcactgtacaaccgcagtaatgcggagcataaatgaccaagttctcttcgttgacaaa
agaaacccgcctgtgttcgaggacatgcctgatatcgaccgaacagccaacgaatcccag
accagactgataatatatatgtacaaagatagtgaagtaagaggactggctgtgacccta
tctgtgaaggatggaaggatgtctaccctctcctgtaaaaacaaaatcatttcctttgag
gaaatgaatccacctgaaaatattgatgatataaaaagtgatctcatattctttcagaaa
cgtgtgccaggacacaacaaaatggaatttgaatcttccctgtatgaaggacactttcta
gcttgccaaaaggaagatgatgctttcaaactcgttttgaaaaggaaggatgaaaatggg
gataaatctgtaatgttcactcttactaacttacatcaaagttag

DBGET integrated database retrieval system