KEGG   Rattus norvegicus (rat): 291981Help
Entry
291981            CDS       T01003                                 

Gene name
Nutf2, NTF2
Definition
(RefSeq) nuclear transport factor 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: NTF2 DUF4440
Motif
Other DBs
NCBI-GeneID: 291981
NCBI-ProteinID: NP_001007630
RGD: 1359213
Ensembl: ENSRNOG00000018945
UniProt: P61972
Structure
PDB: 

Position
19q12
AA seq 127 aa AA seqDB search
MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLP
FQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFR
LALHNFG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaagccaatttgggagcagattggatccagctttattcagcattactatcag
ttatttgataacgacagaacccaactaggcgcaatttacattgatgcgtcatgccttacg
tgggaaggacagcaattccagggcaaagctgccattgtggagaagctatctagccttccg
ttccagaaaattcagcatagtatcacggcgcaggaccatcagcctacaccagatagctgc
atcatcagcatggttgtaggccagctcaaggctgatgaagatcccatcatgggtttccac
cagatgtttctattaaagaacatcaatgacgcttgggtttgcaccaatgacatgttcagg
cttgccctgcacaacttcggctga

DBGET integrated database retrieval system