KEGG   Rattus norvegicus (rat): 291983
Entry
291983            CDS       T01003                                 

Gene name
Psmb10
Definition
(RefSeq) proteasome subunit beta 10
  KO
K02733  20S proteasome subunit beta 10 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    291983 (Psmb10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    291983 (Psmb10)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    291983 (Psmb10)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     291983 (Psmb10)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   291983 (Psmb10)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    291983 (Psmb10)
SSDB
Motif
Pfam: Proteasome Pr_beta_C DUF5331
Other DBs
NCBI-GeneID: 291983
NCBI-ProteinID: NP_001020808
RGD: 1307428
Ensembl: ENSRNOG00000019494
UniProt: Q4KM35
Position
19q12
AA seq 273 aa
MLKQAVEHRGGFSFENCQRNASLEHVLPGLRVPLARKTGTTIAGLVFRDGVILGADTRAT
NDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAASKMELHALSTGREPRVATVTR
ILRQTLFRYQGHVGASLIVGGVDLNGPQLYSVHPHGSYSRLPFTALGSGQDAAVALLEDR
FQPNMTLEAAQELLVEAITAGILGDLGSGGSVDACVITAGGAKLQRALSSPIEPVQRAGQ
YRFAPGTTPVQTQEVRALTLELLEETVQAMEVE
NT seq 822 nt   +upstreamnt  +downstreamnt
atgctgaagcaggcagtggaacacagaggaggcttctctttcgagaactgccagaggaat
gcgtccttggaacacgtccttccgggacttcgggtccctcttgcacgcaagaccgggact
accatcgccggacttgtgttccgtgatggagtcatcctgggtgcggacacgcgggctact
aacgattcggttgtggcggataaaagctgcgagaagatccactttatcgcccccaaaatc
tactgctgtggggctggagtagctgcggacactgagatgaccacgcggatggcagcttcc
aaaatggaactacatgctctgtccaccggccgtgaacctcgagtggccacggtcacccgt
atcttgcgtcagacgctcttccggtaccaaggccacgtgggagcatcattgatcgtgggc
ggggttgatttgaacggaccgcagctctacagcgtgcacccacacggttcctacagccgt
ctgccttttactgcccttggctctggtcaggatgcagccgtggcactgttggaggaccgg
ttccagccaaacatgacgctggaggccgcgcaagagctgttggtggaagccatcacagca
gggatcctgggtgacctaggctctggaggcagtgtggatgcctgtgtgatcactgcagga
ggcgccaaactgcagagagctttgagctcacccatagagcctgtgcagagagctggccag
taccgctttgctcctggaaccacacctgtccagacccaggaagtgagagctctgaccctg
gaacttctggaggaaactgtgcaggctatggaggtggagtaa

DBGET integrated database retrieval system