KEGG   Rattus norvegicus (rat): 291991Help
Entry
291991            CDS       T01003                                 

Gene name
Tmed6, RGD1305260
Definition
(RefSeq) transmembrane p24 trafficking protein 6
  KO
K20351  p24 family protein gamma-5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    291991 (Tmed6)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    291991 (Tmed6)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    291991 (Tmed6)
Transporters [BR:rno02000]
 Other transporters
  Others
   291991 (Tmed6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 291991
NCBI-ProteinID: NP_001099653
RGD: 1305260
Ensembl: ENSRNOG00000020406
UniProt: D3ZJV9
Position
19q12
AA seq 238 aa AA seqDB search
MFALLLEAGLVVLSLVTSAKSQRTDPLHGSKDQPLLRGADRHDFAIVVHPGNTECFWQFA
DQMGYLYFSYEVQRTLGMSHDRHIVATAHTPQGFLIDTSQDVRGQINFATQETGFYQLCL
KNEQNRFSSIQVYLNFGVFYEGPEMDHKQSQRKQLNDTLDAIEDSTRRVQNHVFHMWRFY
NSARMRKVADFFLLQSNYSYVNWWSTAQSLAIVLSGVLQLYFLKRLFTISTDTKKPRC
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctttgcttcttgaggctgggctggtggttctgagcctagtgacttctgctaag
agccagaggacagatcccctacatggctccaaggaccagcccctcctccgtggagctgac
cgacatgactttgccatcgtggtccatccgggaaacacagaatgtttctggcaatttgct
gaccagatgggatacctgtacttcagctatgaggttcagcgcactcttggaatgtcacat
gaccgccacattgttgccacggcacataccccacagggtttccttattgacacctcccag
gatgttcggggccagattaactttgctacacaagagacaggtttctatcagctttgtcta
aaaaatgagcagaatcgcttcagttctatacaagtgtatctcaacttcggagtcttctat
gaggggcccgagatggatcataaacagagtcaaagaaaacagctgaacgatactctggac
gccatagaggacagtacccggagggtgcagaaccacgttttccacatgtggcgcttctac
aactctgccaggatgaggaaggtggctgactttttcctcctgcagtctaactacagctat
gtgaactggtggtccacagctcagagccttgctattgttctttccggggtcctccagctc
tatttcctgaaacggcttttcaccatctcaactgacacaaagaagccaagatgctaa

DBGET integrated database retrieval system