KEGG   Rattus norvegicus (rat): 29200
Entry
29200             CDS       T01003                                 

Gene name
Inhba
Definition
(RefSeq) inhibin beta A subunit
  KO
K04667  inhibin beta A chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29200 (Inhba)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29200 (Inhba)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29200 (Inhba)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29200 (Inhba)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   29200 (Inhba)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 29200
NCBI-ProteinID: NP_058824
RGD: 62074
Ensembl: ENSRNOG00000014320
UniProt: P18331
Position
17q12.1
AA seq 424 aa
MPLLWLRGFLLASCWIIVRSSPTPGSEGHGAAPDCPSCALATLPKDGPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGSLDMGDEAEEMGLKGERSELLLSEKVVDARKSTWHIFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGASLVLLGKKKKKEVDGDGKKKDGSDGGLEEEKEQSHRPFLMLQARQSED
HPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTS
GSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE
CGCS
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcccttgctttggctgagaggatttctgttggcaagttgctggattatagtgaggagt
tcccccaccccaggatccgaggggcacggcgcagccccggactgcccgtcctgtgcgctg
gccacccttccgaaggatggacctaactctcagccagagatggtagaggctgtcaagaag
cacatcttaaacatgctgcacttgaagaagagacccgatgtcacccagccggtacccaag
gcggcgcttctcaacgcgatcagaaagcttcatgtgggtaaagtgggggaaaacgggtat
gtggagatagaggacgacattggcaggagggccgaaatgaatgaactcatggagcagacc
tcggagatcatcacctttgccgagtcaggcacagccaggaagacactgcattttgagatt
tccaaggaaggcagtgacctgtcagtcgtggagcgtgcagaagtctggctcttcctgaaa
gtccccaaggccaacaggaccaggaccaaagtcaccatccgtctgtttcagcagcagaag
catccacagggcagcttggacatgggggatgaggccgaggaaatgggcttgaagggggag
aggagtgaactgttgctatcagagaaagtggtagatgctcggaagagtacttggcacatc
ttcccagtgtctagcagcatccagcgcctgctggaccaggggaagagttccctggatgtg
cggattgcttgtgaacagtgccaggagagcggtgccagcctagtgctcctgggcaagaag
aagaagaaagaggtggatggagacgggaagaagaaagacggaagtgacggagggctggaa
gaggaaaaagaacagtcacacagacctttcctcatgctgcaggctaggcagtctgaagac
catcctcaccgcaggcgtaggcggggcttggagtgtgatggcaaggtcaacatttgctgt
aagaaacagttctttgtcagcttcaaggatattggctggaatgactggatcattgctccc
tctggctatcatgccaactattgtgagggtgagtgcccgagccacatagcaggcacctct
gggtcctcactctccttccactcaacagtcattaaccactaccgcatgaggggtcacagc
ccctttgccaaccttaagtcatgctgtgtgcccaccaagctgagacccatgtccatgctg
tattatgatgatggtcaaaacattatcaaaaaggacattcagaacatgattgtggaggag
tgtggctgctcctag

DBGET integrated database retrieval system