KEGG   Rattus norvegicus (rat): 29201
Entry
29201             CDS       T01003                                 

Gene name
Ctf1
Definition
(RefSeq) cardiotrophin 1
  KO
K05422  cardiotrophin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    29201 (Ctf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29201 (Ctf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29201 (Ctf1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   29201 (Ctf1)
SSDB
Motif
Pfam: LIF_OSM PRF
Other DBs
NCBI-GeneID: 29201
NCBI-ProteinID: NP_058825
RGD: 2442
Ensembl: ENSRNOG00000018962
UniProt: Q63086
Position
1q37
AA seq 203 aa
MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPG
FSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLR
SLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVC
GLYGEWVSRTEGDLGQLVPGGVA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagccagagggagggaagtctggaagaccaccagactgactcctcattctcattccta
ccccatttggaggccaagatccgacagacacacaaccttgcacgcctcctgaccaaatat
gcagaccaattgctggaggaatatgtgcagcaacagggagagccctttgggctgccgggc
ttctcaccaccgcggctgccgctggccggcctgagtggcccggctccgagccacgcgggg
ctaccggtgtccgagcggctgcggcaggatgcagccgccttgagtgctctgcccgcgcta
ttggatgctgtgcgccgccgccaggcggagctgaacccacgcgccccgcgcctactgcgg
agcctggaggacgctgcccgccaggttcgggccctgggcgccgcggtggagaccgtgctg
gccgctctgggcgctgcagcccgcgggcccgtgccagagcctgtcgccacctccgccctc
ttcacctccaacagtgcggcaggcgtcttctcagctaaggtgctggggctccacgtgtgc
ggcctctatggcgagtgggtgagccgcaccgagggtgacctgggccaactggtgccaggg
ggcgttgcctga

DBGET integrated database retrieval system