KEGG   Rattus norvegicus (rat): 292058
Entry
292058            CDS       T01003                                 

Gene name
Gins2, RGD1311055
Definition
(RefSeq) GINS complex subunit 2
  KO
K10733  GINS complex subunit 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    292058 (Gins2)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   GINS complex
    292058 (Gins2)
SSDB
Motif
Pfam: Sld5
Other DBs
NCBI-GeneID: 292058
NCBI-ProteinID: NP_001099660
RGD: 1311055
Ensembl: ENSRNOG00000017575
UniProt: D3ZSY6
Position
19q12
AA seq 185 aa
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVDVPLWLAINLKQRQKCRL
LPPEWMDVEKLEQMRDEERKEETFTPVPSPHYMEITKLLLNHASDNIPKADTIRTLIKDL
WDTRMAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGAFLTQALNHMYKLRTNLQPSESS
QSQDF
NT seq 558 nt   +upstreamnt  +downstreamnt
atggacgcggccgaggtggagtttttggccgagaaggagctggtaactatcatcccgaac
ttcagtctggacaagatctacctgatcgggggggacctggggcccttcaaccccggctta
cccgtggacgtgcccctgtggctggccattaacctgaaacagagacagaagtgccgtctg
ctacctccagagtggatggatgtggagaaattggagcagatgcgggatgaggagcggaag
gaggagactttcaccccggtgcccagcccacactacatggagatcacgaagctcctgctg
aatcatgcttctgacaacattcccaaagcagacaccatccggacactgatcaaagatctg
tgggacacacgcatggccaagcttcgggtgtctgctgacagttttgtgcggcagcaagag
gcacatgctaagctggacaacttgaccttgatggagatcaacaccagtggggccttcctc
acccaagctctcaaccacatgtacaaactccgcacgaaccttcagccctctgagagctca
cagtctcaggacttctag

DBGET integrated database retrieval system