KEGG   Rattus norvegicus (rat): 292060Help
Entry
292060            CDS       T01003                                 

Gene name
Irf8, ICSBP, Icsbp1
Definition
(RefSeq) interferon regulatory factor 8
  KO
K10155  interferon regulatory factor 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05133  Pertussis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    292060 (Irf8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    292060 (Irf8)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    292060 (Irf8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF MH2
Motif
Other DBs
NCBI-GeneID: 292060
NCBI-ProteinID: NP_001008722
RGD: 1312024
Ensembl: ENSRNOG00000017869
UniProt: Q5NUI4
Position
19q12
AA seq 424 aa AA seqDB search
MCDRNGGRRLRQWLIEQIDSSMYPGLIWESEEKTLFRIPWKHAGKQDYNQEVDASIFKAW
AVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKC
KLGVAPAGCMSDVTEMECGRSEIEELIKEPSVDEYMGIAKRSPSPPEACRSQILPDWWAQ
QPNAGLPLVTGYTAYDAHHSALSQMVINFYYGGKLVGQATTTSLEGCRLSLSQPGLPKLY
GPDGLEPVCFPAADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGN
AVVCKGRPNKLERDEVVQVFDTNMFLRDLQQFYATQSRLPDSRVVLCFGEEFPDTAPLRS
KLILVQVEQLYARQMVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQ
QITV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaccggaatggcgggcggcggctgcgacagtggctgatcgaacagattgacagc
agcatgtacccggggctgatctgggagagtgaggagaagaccctgttccgcatcccctgg
aaacacgcaggcaagcaagactacaaccaggaagtggacgcttcaatcttcaaggcctgg
gcagtttttaaagggaagtttaaagagggagacaaagctgagccagccacgtggaagaca
cggttacgctgcgctctgaacaagagcccggattttgaagaggtgaccgaccggtcccag
ctggacatttccgagccatacaaagtttaccgaatcgtccccgaggaagagcaaaaatgc
aagctgggcgtggcacctgcgggctgcatgagcgacgtcacggagatggagtgtggccgt
tcagagatcgaggagctgatcaaggagccttctgtggatgaatacatgggaatagccaaa
aggagcccatcccctccagaggcctgcaggagccagatcctccctgactggtgggcccag
cagcccaacgcaggcctgccactggtgactgggtatactgcctatgacgcacaccattca
gccttatcccagatggtgatcaacttttactacgggggcaagctggtgggccaggccacc
accacctcccttgagggctgccgcctatccctgagccagccggggctgccgaagctgtat
gggccggacggcctggagcccgtgtgcttcccggcggcggacaccatccccagtgagcgg
cagaggcaggtgacccggaagctgtttggacacctggagcgcggcgtgctcctgcacagc
aaccgcaagggtgtgttcgtgaagcggctgtgccagggccgcgtgttctgcagcggcaac
gcggtggtgtgcaagggtagacccaacaagctggagcgggatgaggtggtgcaggtcttt
gacaccaacatgttcctccgagacctgcagcagttctacgccacccagagccgcctgcct
gatagcagggtggttctgtgctttggggaggagtttccagacacagcgcccttgcgctcc
aaactcattctggtgcaggtagagcagctgtatgccaggcagatggtggaggaagcgggc
aagagctgtggggcaggctccctgatgccagccctggaggaaccccagccagaccaggcc
tttcggatgtttccagatatctgtacctcacaccagagaccctttttcagagaaaatcaa
cagatcaccgtctaa

DBGET integrated database retrieval system