KEGG   Rattus norvegicus (rat): 292064Help
Entry
292064            CDS       T01003                                 

Gene name
Banp
Definition
(RefSeq) Btg3 associated nuclear protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BEN DUF1845
Motif
Other DBs
NCBI-GeneID: 292064
NCBI-ProteinID: NP_001099661
RGD: 1307464
Ensembl: ENSRNOG00000019140
UniProt: B1H235
Position
19q12
AA seq 548 aa AA seqDB search
MMSEQDLADVVQIAVEDLSPDHPVVLENHVVTDDDEPALKRQRLEINCQDPSIKSFLYSI
NQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVR
CVVPQTTVILNNDRQNAIVAKMEDPLSNRAPDSLENIISNAVPGRRQNTIVVKVPGQDDS
HNEDGESGSEASDSVSNCGQPGSQNIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRCA
IIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCH
LFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPSSSSYSASETMMGT
PPPTSELQQSQPQALHYALANAQQVQIHQIGEDGQVQVIPQGHLHIAQVPQGEQVQITQD
SEGNLQIHHVGQDGQSWGLCQNPIPVSGDSVAQANPSQLWPLGGDTLDLPAGNEMIQVLQ
GAQLIAVASSDPAATGVDGSPLQGSDIQVQYVQLAPVSDHTAATQTAEALQPTLQPEMQL
EHGAIQIQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagagcaggacctggcagatgtggttcagattgcagtggaagacttgagtcct
gaccacccagttgttttggagaatcatgtcgtgacggatgatgatgagcctgctttgaag
cgccagcgactagagatcaattgccaggatccctctataaagtctttcctgtactctatt
aaccagacgatatgtttgcggttggatagcattgaggccaagttgcaagctcttgaggct
acttgcaaatctctggaggagaagctagacctggtcaccaataaacagcacagtcccatc
caggtccctatggtggctggttccccacttggcgccacccagacctgcaacaaagtgcga
tgcgtcgtcccccagactacagtaatactcaacaatgatcggcagaacgccattgtagcc
aagatggaagacccattgagcaacagggcaccggattccctggaaaatatcattagcaac
gctgttcctgggcgtcggcagaataccatcgtggtgaaggtgcctggtcaggacgacagt
cacaatgaagatggagagagtggatcagaggccagtgactccgtgtctaactgcggccag
ccaggaagtcagaacattggaagcaacgtcacacttatcaccctgaactctgaagaggac
tatcccaatggcacctggctgggtgatgagaataaccctgagatgcgggtacgttgtgcc
atcatcccctccgacatgctgcacatcagcacgaactgtcgcaccgctgagaagatggcg
ctgacgctgctggactacctgttccaccgtgaggtgcaggctgtgtccaacttgtcgggc
cagggcaagcacgggaagaagcagctggaccccctcactatctatggcatccggtgtcac
ctcttctataaatttggaatcacggaatctgattggtatcggatcaagcagagcattgac
tccaagtgccgtacagcctggcggcggaagcagcgaggccagagcctggcggtcaagagc
ttctctcggaggacaccatcctcatcctcctacagtgcctcagagaccatgatgggaacc
cctccacctaccagtgagctacagcagtcacagccacaggccctacactacgcattggcc
aacgcacagcaagtccagatccaccagattggagaggacggacaggtgcaagtaattcca
cagggccacctacatattgcccaggtgcctcaaggggagcaggtgcagatcacacaggac
agtgagggcaatctgcagatccatcacgtgggtcaggatggacagtcgtggggcctgtgc
cagaatcccattcctgtgagcggtgactcagtggcccaggctaacccctcccagctttgg
cctctgggaggagacacacttgatctgcctgctggaaatgagatgatccaggtactgcag
ggtgctcagctcatagccgtggcctcttcagaccctgcagctacaggagtagatgggtcg
cctctccagggcagtgacattcaggttcagtatgtccagctggcgcccgtgagtgaccac
acggctgcaacgcagacagctgaggcactgcaacccactctgcagcctgaaatgcagctt
gaacacggggccatccagatccagtga

DBGET integrated database retrieval system