KEGG   Rattus norvegicus (rat): 292067Help
Entry
292067            CDS       T01003                                 

Gene name
Zc3h18, Nhn1
Definition
(RefSeq) zinc finger CCCH-type containing 18
  KO
K13092  nuclear protein NHN1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    292067 (Zc3h18)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   General mRNP proteins
    292067 (Zc3h18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH_4 zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 292067
NCBI-ProteinID: NP_958819
RGD: 1303257
Ensembl: ENSRNOG00000028501
UniProt: Q6TQE1
Position
19q12
AA seq 971 aa AA seqDB search
MDVAESPELEPHSPDEEQPALSDDDILRESGSEQDLDGAGERASDLEEEENATRVQSQEE
IHSDEEDQASEPKSQDQDSEAHELSRGPAGSPCEEGDDAEEDGTSDLRDEASSVTRELDE
HELDYDEEVPEEPAPAAQEEEAEKAGAEEEEEKGEGAPGEEGKPDVQSVGEKEPTEAAKE
KKKEDDDGEIDDGEIDDDDLEEGEVKDPSDRKVRPRPTCRFFMKDVVTPLSTLLPPIPNS
IPLRGQVKGNCTWGMNCRFIHPGVNDKGNYSLITKAEPFPPNGAPPLGPHPLMPANPWGG
PVVDEILPPPPPEPPTESAWERGLRHAKEVLKKATIRKEQEPDFEEKRFTVTIGEDDREF
DKENEVFRDWNSRVPRDVRDTTLEPYADPYYDYEIERFWRGGQYENFRVQYTEAEPYHNY
RDRERERERENRQRERERDRERDRERERRQRERERERERERDKERQRRKEEWERERAKRD
EKDRQHRDRDRDKDRDKDKEKPKPRSPQPPSRQAEPPKKETASVGPQVKRADEWKDPWRR
SKSPKKKLGVSVSPSRARRRRKTSASSASASNSSRSSSRSSSYSGSGSSRSRSRSSSYSS
YSSRSSRRSSFSGSRSRSRSFSSSPSPSPTPSPHRPPVRTKGEPAPPPGKAGEKSIKKPA
PPPAPPQATKTTAPAPEPAKPGDLREARRKERQTRTPPRRRTLSGSGSGSGSSYSGSSSR
SRSLSVSSVSSVSSATSSSSSVHSVDSDDMYADLASPVSSASSRSPTPAQTKKERGKSKK
EDGVREEKRKRDPSAQPPKSSKAPAGGKASQQAAAPQQAAPGQPQQGSFVAHKEIKLTLL
NKAAEKGSRKRYEPSDKDRQSPPAKKANLSPDRGSRDRKSGGRMGSPKPERQRGQNAKAP
AAPADRKRPLSPQSKSSSKVTSVPGKATDTATAGTKSGKASTLSRREELLKQLKAVEDAI
ARKRAKIPGKV
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggccgagagccctgaactggagcctcactccccggatgaagagcagccggca
ctttcagatgatgacattctgagggaaagtgggtctgaacaagatttggatggagctggg
gaaagggcttctgatttggaggaagaggaaaatgcaactagagtacaaagccaggaggag
attcactcagatgaggaagaccaagccagtgagcccaagtcccaggatcaggactcagag
gctcatgagctgagcaggggcccagcaggatccccatgcgaggagggggatgatgctgag
gaagatgggacaagtgatctcagggacgaagcctcctcagtgaccagggaactggatgag
cacgagctagactatgatgaggaggtccctgaggaaccagctcctgctgcccaggaggag
gaagctgagaaggctggggccgaggaggaggaggaaaagggagaaggggctcctggagag
gaagggaagcctgatgttcaaagtgtgggagaaaaagaacccacagaagctgccaaggag
aagaagaaagaggatgacgatggagagatcgacgacggggagatagatgatgacgacctg
gaggaaggcgaagtgaaggaccccagtgaccggaaggtgaggccacgccccacctgccga
ttcttcatgaaagatgttgtgacaccattatccactcttcttccaccaataccaaattcc
ataccactcagaggccaggttaaaggaaactgcacgtggggaatgaactgtaggtttata
caccctggagtgaatgacaaggggaactactccctcatcaccaaagcggaaccctttcca
cccaacggtgccccgcctcttggacctcacccactgatgcctgccaacccttggggtggg
ccagtagttgatgaaattttgcctccaccccctccagagcccccaacagagagtgcctgg
gaacgtggactcagacatgcaaaagaggttttaaaaaaagcaaccattcggaaagagcag
gagcctgactttgaagaaaaaaggttcacagtaaccattggtgaagacgaccgggaattt
gacaaggaaaatgaagtcttccgagattggaattctcgggtcccacgagatgtcagagac
acaacacttgagccttatgcagatccttattatgactatgagatagagcgtttttggcgt
ggtggacagtacgagaatttcagggtgcagtatacagaagcagagccgtatcataactac
cgcgaccgagagagggagcgagagcgagagaacagacaacgggaacgggaacgcgaccga
gagcgtgaccgagagcgcgagcgcaggcagagagagcgcgagcgggaacgggagcgggaa
cgggacaaggagcggcagcggaggaaagaggagtgggagagagagagagccaagcgagat
gagaaggaccggcaacaccgagaccgagacagggacaaggaccgggacaaggacaaggag
aagccgaagccccggtccccacagccaccgagccgtcaagctgaaccaccaaagaaggag
accgcctctgtggggccacaggtgaagcgagccgatgagtggaaggacccgtggcgccga
tccaagtctcccaagaagaaacttggtgtgtcagtctccccaagccgggcacgaaggcgt
cgcaagacatccgcctcatcagcttctgcttccaattcctccaggtcatcgtcacggtct
tcatcctactctggctctggctcgtcccggtcccggtcccggtcctcctcctatagctcc
tactccagccgctcttccagacgcagttccttctcaggcagccggtccaggtcccggtcc
ttctcctcgtccccatccccatctcccacaccttccccacacagacctccagtcagaacc
aagggggagccggccccgcctcccgggaaagcaggggagaagtcaataaagaagccagcc
ccgcccccagccccaccacaggccaccaaaactactgcacctgctcctgagcctgccaag
cctggagatctccgagaagccaggagaaaggaacggcaaaccaggactcccccaaggagg
cggacgctcagcggcagtggcagcggcagtggtagcagctacagtggctccagttcccga
tccaggtctctgagtgtgagcagcgtttcctcggtgtccagtgccacctcgagtagcagc
tcagtgcacagtgtggactcagatgacatgtatgcagacctggccagtcctgtgtcatca
gccagctctcgatcccctaccccagcacagaccaagaaggagagagggaaatctaagaaa
gaagacggagtgagagaggagaagcggaaacgggacccatccgcacagccacccaagtcc
tccaaagcccccgcaggtgggaaggcctcccagcaggcagcggcacctcagcaggcggcc
cctgggcagccccaacagggctcctttgtcgctcacaaggagataaagctgacattgctg
aacaaggcggctgagaaaggaagccggaagcgctatgagccctcagacaaggaccggcag
agccctcctgccaagaaggccaacttgtccccagaccgaggttctcgagaccggaaatcg
ggtggaagaatgggctccccgaaaccagagaggcagaggggccagaatgctaaagctcct
gctgccccagcggacaggaagcgcccactgtcgccccagtctaagagctccagcaaggtc
accagtgtgcccggcaaagccacagacactgccacagcaggcactaagtcagggaaggcc
agcacattgtcccggcgagaggagctccttaaacagctcaaggccgttgaggatgccatc
gctcgcaagcgggccaagattcccgggaaagtgtag

DBGET integrated database retrieval system