KEGG   Rattus norvegicus (rat): 292072Help
Entry
292072            CDS       T01003                                 

Gene name
Aprt
Definition
(RefSeq) adenine phosphoribosyl transferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    292072 (Aprt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    292072 (Aprt)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     292072 (Aprt)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   292072 (Aprt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-GeneID: 292072
NCBI-ProteinID: NP_001013079
RGD: 1307758
Ensembl: ENSRNOG00000014405
UniProt: P36972
Position
19q12
AA seq 180 aa AA seqDB search
MSESELQLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRLLAGHLKSTHGGKIDY
IAGLDSRGFLFGPSLAQELGVGCVLIRKRGKLPGPTVSASYSLEYGKAELEIQKDALEPG
QKVVIVDDLLATGGTMCAACELLSQLRAEVVECVSLVELTSLKGREKLGPVPFFSLLQYE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaatctgagttgcagctggtggcgcggcgcatccgcagcttcccggacttcccc
atcccgggcgtgctgttcagggatatctcgcccctcttgaaagatccggactccttccga
gcttccatccgcctcctggccggtcacctgaagtccacgcacggcggcaagatcgactac
atcgcaggtctggactccaggggcttcctgtttggcccttcccttgctcaggagctgggg
gtgggctgtgtgctcatccgtaagcgcgggaagctaccaggccccactgtatcagcctcc
tattctctagagtatgggaaggctgagctggaaatccagaaagatgccttagaaccgggg
cagaaagtggtcattgtggatgatctcctggccactggaggaaccatgtgtgcagcctgt
gagctgctgagccagctgcgggctgaggtggtggagtgtgtgagcctggtggagctgacc
tccctgaagggcagggagaagctgggacctgtgccattcttctctctcctgcagtatgag
tga

DBGET integrated database retrieval system