KEGG   Rattus norvegicus (rat): 292073
Entry
292073            CDS       T01003                                 

Gene name
Galns
Definition
(RefSeq) N-acetylgalactosamine-6-sulfatase precursor
  KO
K01132  N-acetylgalactosamine-6-sulfatase [EC:3.1.6.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00077  Chondroitin sulfate degradation
rno_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    292073 (Galns)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    292073 (Galns)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.4  N-acetylgalactosamine-6-sulfatase
     292073 (Galns)
SSDB
Motif
Pfam: Sulfatase Sulfatase_C Phosphodiest
Other DBs
NCBI-GeneID: 292073
NCBI-ProteinID: NP_001041316
RGD: 1565391
Ensembl: ENSRNOG00000014461
UniProt: Q32KJ6
Position
19
AA seq 524 aa
MTACSTAIRAQQLLLPVLSALGLLAAGAPQPPNIVLLLMDDMGWGDLGVYGEPSRETPNL
DRMAAEGMLFPSFYSANPLCSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIMGGIPN
SEHLLPELLKKAGYTNKIVGKWHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKVKPNIP
VYRDWEMVGRFYEEFPINLKTGEANLTQLYLQEALDFIRTQHARQSPFFLYWAIDATHAP
VYASKQFLGTSLRGRYGDAVREIDDSVGKILSLLQNLGISKNTFVFFTSDNGAALISAPK
EGGSNGPFLCGKQTTFEGGMREPAIAWWPGHIAAGQVSHQLGSIMDLFTTSLSLAGLKPP
SDRVIDGLDLLPTMLQGHIIDRPIFYYRGNTLMAVTLGQYKAHLWTWTNSWEEFRQGIDF
CPGQNVSGVTTHTQEEHTELPLIFHLGRDPGERFPLRFTSNEYQDALSRTTQVIQQHQKS
LVPGQPQLNVCNQAVMNWAPPGCEKLGKCLTPPESVPEKCFWAH
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgacggcctgttccacagcgatcagggcccagcagctactgctgccggtactgagtgct
ctaggactcttggctgcaggtgctccgcagccccccaacattgtgctactgctcatggac
gatatggggtggggtgacctgggtgtgtatggagaaccttccagagagaccccaaattta
gaccggatggctgcagaagggatgcttttcccaagcttctattctgccaaccctttgtgc
tcaccatctagggcagccctgctcacaggacggttgcccatccgcaatggcttctacaca
accaacgcacatgcaaggaatgcttacacacctcaggagatcatgggcgggatccctaac
tcagaacacctcctgcctgagctcctgaagaaagcaggctataccaacaagatcgtgggc
aaatggcatctgggtcatagaccccagttccaccccctgaagcatggatttgatgagtgg
tttggatcccccaattgtcattttggaccatacgacaacaaggtcaagcccaacatccct
gtgtacagggactgggaaatggttggcagattttatgaagagttcccaatcaacctaaag
accggggaagctaacctcacccaactctacttacaagaagctctggacttcatccggaca
caacatgcaaggcagagccccttcttcctctactgggccatcgacgccacacacgcacca
gtgtatgcctcaaaacagttcctgggtaccagccttcgagggcgttatggcgatgctgtc
cgggaaatagatgacagtgttggaaagatcctgagccttctgcagaacttgggcatcagt
aagaacacatttgtcttctttacgtctgacaatggtgcagcgctcatctctgctcccaaa
gaaggtggcagcaatggtcccttcctgtgtgggaagcagactacgtttgaaggcgggatg
agggagcctgcaatcgcttggtggccagggcacattgccgcaggccaggtcagccaccag
ctgggaagcatcatggacctcttcaccaccagcctgtcccttgcaggcctgaagcccccc
agtgacagggtaattgatggccttgacctcctccccaccatgctccagggccacatcata
gacaggcccatattttattaccgtggcaacacactgatggcagtcactcttggccagtac
aaagcacacctctggacttggaccaactcctgggaggagttcagacagggcattgacttc
tgccccgggcagaatgtttcaggagtcacaacccacacccaggaagagcacacggagcta
cccctgatcttccacctgggacgtgacccaggggagagattcccactcaggttcaccagc
aatgagtaccaggatgccctcagcaggaccacccaggtcatccagcaacaccaaaagtct
ttggtccctggacagccccagctcaatgtgtgtaaccaggctgtcatgaattgggcgcct
ccaggctgtgaaaaactagggaagtgtctgacacctcctgagtctgtccccgagaagtgt
ttctgggcccattag

DBGET integrated database retrieval system