KEGG   Rattus norvegicus (rat): 292078Help
Entry
292078            CDS       T01003                                 

Gene name
Spata33, RGD1561507
Definition
(RefSeq) spermatogenesis associated 33
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4609 FAM60A GREB1 DUF4674
Motif
Other DBs
NCBI-GeneID: 292078
NCBI-ProteinID: NP_001099665
RGD: 1561507
Ensembl: ENSRNOG00000038239
UniProt: D3Z8L2
Position
19q12
AA seq 136 aa AA seqDB search
MGQSKSKPGEKKVEEEKKITTTLVTKAKEKVMEKETKQSDKESQPAESMMFGSKTSKHSR
PSSSSEDKPDTKQRSSKKRSVIPQIIITRASNETLISYGIPDSDEQRTIREHADWGPYYR
HRSPSTIAAYEVQNTE
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgggccagtcgaaaagcaaacccggagagaagaaagttgaggaggaaaagaagatcact
accactttagttacaaaggctaaggagaaagtaatggagaaggagaccaagcagtctgac
aaggagtctcagcctgccgaaagcatgatgttcgggtcaaagacatccaagcactcaagg
ccttcgtcttcctctgaagacaaacctgacacaaagcaaaggtcaagcaagaagagaagt
gtcatcccacagatcatcatcacccgggcctcaaacgagacgctcatcagctatggcatc
cccgacagcgatgaacagagaaccattcgggagcatgccgactggggcccatactaccga
cacaggagccccagcacaatagcagcctatgaggtgcagaacacagaataa

DBGET integrated database retrieval system