KEGG   Rattus norvegicus (rat): 29209Help
Entry
29209             CDS       T01003                                 

Gene name
Casq2, cardCSQ
Definition
(RefSeq) calsequestrin 2
  KO
K23445  calsequestrin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29209 (Casq2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29209 (Casq2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calsequestrin Thioredoxin_6
Motif
Other DBs
NCBI-GeneID: 29209
NCBI-ProteinID: NP_058827
RGD: 2276
Ensembl: ENSRNOG00000016243
UniProt: P51868
Position
2q34
AA seq 413 aa AA seqDB search
MKRIYLLVVGLYLLSFSRAEEGLNFPTYDGKDRVVSLSEKNLKQVLKRYDLLCLYYHEPV
SSDKVAQKQFQLKEIVLELVAQVLEHKNIGFVMVDSRKEAKLAKRLGFSEEGSLYVLKGG
RTIEFDGEFAADVLVEFLLDLIEDPVEIVNNKLEVQAFERIEDQIKLLGFFKNEDSEYYK
AFQEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVGFYEPFMDEPSVIPNKPYTEEELVEF
VKEHQRPTLRRLRPEDMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPD
LSILWIDPDDFPLLVAYWEKTFKIDLFKPQIGVVNVTDADSVWMEIPDDDDLPTAEELED
WIEDVLSGKINTEDDDNEDEDDDGDNDNDDDDDDDDNSDEDNDDSDDDDDDDE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggatttacctgctcgtggtggggctttatctgctgtcctttagcagggcagaa
gaggggctgaacttccccacgtacgatgggaaggaccgagtggtcagcctttctgagaag
aacttgaagcaagtgttgaagagatacgatttgctctgtctctactaccacgagcctgtg
tcttcagacaaggtcgcacagaagcagttccaactgaaggagatcgtactggagcttgtg
gcccaggttctggaacataaaaacataggctttgtgatggtggattcaaggaaagaggcc
aagcttgccaagaggctgggcttcagtgaagaaggaagcctgtatgttctgaagggtggt
cgcaccattgagtttgacggggaatttgcagcagatgtcttggtggaatttctcttggac
ctcattgaggacccagtagagatcgtgaacaacaagttggaagtccaagcctttgagcgc
atcgaggaccagatcaagctgcttggctttttcaagaatgaggactcagaatattacaaa
gcgttccaagaggcagctgaacacttccagccttacatcaagttctttgccacctttgac
aagggggtggcaaagaagttgtccttgaagatgaatgaagttggcttctatgagccattt
atggatgaacccagtgtcatccctaacaagccctacacagaagaggagcttgtggagttt
gtgaaggagcatcaaagacccaccctacgtcgcttgcgcccagaggacatgtttgaaaca
tgggaagacgacttgaatggaatccacattgtggcatttgcggagaagagtgacccagat
ggctatgagttcctggagatcctaaaacaggttgcccgggacaacactgacaaccctgac
ttgagcatcttgtggattgacccagacgactttcctctgcttgttgcttactgggagaag
actttcaagattgacctgttcaagccacagattggggtggtgaatgtaaccgatgctgac
agtgtctggatggagatcccagatgatgacgacctgcccacagctgaggagctggaagac
tggattgaggatgtgctttctggaaagatcaatactgaagacgatgacaatgaagatgaa
gatgatgatggcgataatgacaatgacgatgacgatgacgacgatgataattctgatgag
gataatgatgacagtgatgatgacgatgatgacgatgaataa

DBGET integrated database retrieval system