KEGG   Rattus norvegicus (rat): 292098Help
Entry
292098            CDS       T01003                                 

Gene name
Pgbd5
Definition
(RefSeq) piggyBac transposable element derived 5
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DDE_Tnp_1_7 HEPN
Motif
Other DBs
NCBI-GeneID: 292098
NCBI-ProteinID: NP_001099668
RGD: 1310825
Ensembl: ENSRNOG00000026791
UniProt: D3ZSZ4
Position
19q12
AA seq 409 aa AA seqDB search
MPPSASAVDFFQLFVPDNVLKNMVVQTNMYARKFQERFGSDGAWVEVTLAEMKAFLGYVI
STSVSHCESVLSIWSGGFYSNRSLALVMSQARFEKILKYFHVVAFRSSQTTHGLYKVQPF
LDSLQSGFDAAFRPSQTQVLHEPLIDEDPVFIATCTERELRKRKKRKFSLWVRQCSSTGF
IIQIYVHLKEGGGPDGLDALKNKPQLHSMVARSLCRNAAGKNYIIFTGPSITSLTLFEEF
EKQGIYCCGLLSSRKSDCTGLPPSMLTNPATPLARGQHQIRTKGNMSLICWYNKGHFRFL
TNAYSPVQQGVIIKRRSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISHKPNKTWQQVF
WFAISIAVNNAYILYKMSDAYHVKRYSRAQFGERLVRELLGLEDESPAH
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccagcgctagcgcggtggacttcttccagctctttgtcccggacaacgtgctc
aagaacatggtggtgcagaccaacatgtacgccaggaagttccaggagcgttttggcagt
gacggtgcctgggtggaggtgacactggcagagatgaaggccttcctgggctacgtgatc
tctaccagtgtctcgcactgtgagtcagtactcagcatttggagtggaggcttctatagc
aaccggagcctcgccctcgtcatgagccaggcgcgtttcgagaagatcctcaagtatttc
catgttgtggccttccgttccagccagaccacgcacgggctctacaaggtccagcccttt
ctcgactccctgcagagtggctttgacgctgccttcaggccatcccagacccaggtgcta
catgaacccctgattgacgaggaccctgtgttcattgccacgtgcacggagcgagagctg
cggaagcggaaaaagcggaaattcagcctgtgggtccgccaatgctcttccacgggcttc
atcatccagatctatgtccacctaaaggaaggcggcggccccgatggcctggacgctctg
aagaacaagccacagctgcacagcatggtggcccggagcctgtgccggaacgcggctggg
aagaactacatcatcttcacagggcccagcatcaccagcctcactctgtttgaagaattt
gagaagcaaggcatctactgctgtggtctcctcagctccaggaagagtgactgcacaggc
ctccctccatccatgctgaccaaccctgccaccccactcgcccggggccagcaccagatc
aggacaaagggtaacatgtctctgatctgctggtacaacaaggggcacttccgcttcctg
accaacgcctactccccagtgcagcaaggcgtcatcatcaagcgtcggagcggggaaatc
ccctgccctctggccgtggaggcttttgctgctcacctcagctacatctgcagatacgac
gacaagtacagcaagtatttcatctctcacaagccaaacaagacatggcagcaagtgttc
tggtttgccatcagcatcgccgtcaacaacgcctacatcctgtacaaaatgtcagacgcc
taccatgtgaagaggtacagccgggcccagtttggagagagacttgtgagggagctgctg
ggcctggaggacgaatcaccagcccactga

DBGET integrated database retrieval system