KEGG   Rattus norvegicus (rat): 29213Help
Entry
29213             CDS       T01003                                 

Gene name
Tubb4a, Tubb4
Definition
(RefSeq) tubulin, beta 4A class IVa
  KO
K07375  tubulin beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04540  Gap junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29213 (Tubb4a)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    29213 (Tubb4a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29213 (Tubb4a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29213 (Tubb4a)
   04147 Exosome [BR:rno04147]
    29213 (Tubb4a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     29213 (Tubb4a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    29213 (Tubb4a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29213 (Tubb4a)
  Exosomal proteins of colorectal cancer cells
   29213 (Tubb4a)
  Exosomal proteins of bladder cancer cells
   29213 (Tubb4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 29213
NCBI-ProteinID: NP_543158
RGD: 619730
Ensembl: ENSRNOG00000047505
UniProt: B4F7C2
Position
9q12
AA seq 444 aa AA seqDB search
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEAEEEVA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaaatcgtgcacctgcaagccgggcaatgcggcaaccagatcggggccaagttc
tgggaggtcatcagtgatgagcatggcatcgaccccactgggacctatcatggggacagt
gacctccagctggagagaattaatgtctactacaacgaggccacaggtggaaattatgtt
cccagagccgtgctggttgacctagaacctggcaccatggactccgtccgctctggccct
tttggccagatcttccggccagacaactttgtgtttggtcaatctggagcaggcaacaac
tgggccaagggtcattacactgagggcgcagagttagtggatgcagtcctggacgtggtg
cgcaaagaggctgaaagctgcgactgtctccagggcttccagctcacccactcgctcgga
ggtggcacaggctcagggatggggaccttgctcatcagcaagatccgggaggagttccca
gacaggatcatgaatacgttcagcgtagtgccatcgcccaaggtgtctgacacggtggtg
gaaccctacaatgccacactgtctgtgcatcaactggtggagaacactgatgagacctac
tgtatcgacaatgaggccttgtacgacatctgcttccgcactctcaagctgaccacgccc
acctacggggacctcaaccacctagtgtcggccaccatgagtggggtgaccacctgcctg
cgctttcccggccagctcaatgcagatctacgcaagctggctgtgaacatggtgccgttc
ccccgtctccacttcttcatgccaggattcgcacccttgaccagcaggggcagccagcag
taccgagccctcaccgttcctgagctgacccaacagatgttcgatgctaagaacatgatg
gccgcgtgcgacccgagacacggtcgctacctgaccgtggctgctgtcttccgaggacgg
atgtccatgaaggaggtggacgagcagatgctaagtgtgcagagcaagaacagcagctac
ttcgttgagtggatccccaacaacgtcaagacagccgtgtgtgacatcccaccccgaggc
ctgaagatggcagccaccttcatcggcaatagcacagccatccaggagctgttcaaacgc
atctcagagcagttcaccgccatgtttaggcgcaaggccttcctgcattggtacacgggt
gaaggcatggacgagatggagtttacggaagcagagagcaatatgaacgacctggtgtcc
gagtaccagcagtatcaggatgccacggctgaagagggcgagttcgaagaggaggccgaa
gaggaggtggcttaa

DBGET integrated database retrieval system