KEGG   Rattus norvegicus (rat): 29214Help
Entry
29214             CDS       T01003                                 

Gene name
Tubb5, Tubb
Definition
(RefSeq) tubulin, beta 5 class I
  KO
K07375  tubulin beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04540  Gap junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29214 (Tubb5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    29214 (Tubb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29214 (Tubb5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29214 (Tubb5)
   04147 Exosome [BR:rno04147]
    29214 (Tubb5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     29214 (Tubb5)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    29214 (Tubb5)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29214 (Tubb5)
  Exosomal proteins of colorectal cancer cells
   29214 (Tubb5)
  Exosomal proteins of bladder cancer cells
   29214 (Tubb5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 29214
NCBI-ProteinID: NP_775125
RGD: 628596
Ensembl: ENSRNOG00000061216
Vega: OTTRNOG00000001525
UniProt: P69897
Position
20p12
AA seq 444 aa AA seqDB search
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDFGEEAEEEA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaatcgtgcacatccaggccggacagtgtggcaaccagatcggtgctaagttc
tgggaggtgataagcgatgaacacggcatcgaccccaccggcacctaccacggagacagc
gacttgcagctggaccgaatctctgtgtactacaatgaagctacaggtggcaagtatgtc
cctcgagctatcttagtggatctagaacccgggactatggactccgttcgctcaggtcct
tttggccagatcttcagaccggacaactttgtttttggtcagtctggggcaggcaacaac
tgggctaagggtcactacacagagggagctgagctggttgactctgtcttggatgtggtg
cggaaggaggcggagagctgtgactgcctgcaaggctttcagctgacccattcgctgggt
ggaggcacgggctctggcatgggcaccctgctcatcagcaagattcgagaagaatacccc
gaccgcatcatgaacacctttagcgtggtgccctcacccaaagtgtctgacaccgtggtt
gagccctacaacgccaccctgtccgtccaccagttggtagagaacacagatgagacctac
tgcattgacaacgaggccctctacgacatctgcttccgtacccttaagctcaccacgcca
acctacggagacctgaaccatctcgtctctgccaccatgagcggtgtcaccacctgcctc
cgtttcccgggccagctgaacgccgaccttcggaagctggctgtcaacatggtgcccttc
ccgcgtctccacttctttatgcctggctttgcccctctcaccagccgtggaagccagcag
taccgggccctcactgtgcctgaactcacccagcaggtcttcgacgccaagaacatgatg
gccgcctgtgacccacgccacggccggtacctcacggttgcggctgtcttccgtggacgg
atgtccatgaaggaggtagatgagcaaatgctcaacgtgcagaataagaatagcagctac
ttcgtggaatggatccccaacaacgtcaagacggctgtctgtgacatcccaccgcgaggc
ctcaagatggcagtcaccttcatcggaaacagcacggccatccaggagctcttcaagcgc
atctctgagcagtttacggcaatgttccgtcggaaggctttcctccactggtacacgggt
gagggcatggacgagatggagttcaccgaagctgagagcaacatgaatgacctcgtctct
gagtatcagcagtaccaggacgccaccgcagaagaggaagaggatttcggagaggaggca
gaagaagaggcctaa

DBGET integrated database retrieval system