KEGG   Rattus norvegicus (rat): 292148
Entry
292148            CDS       T01003                                 

Gene name
Eif3a, Eif3s10, ZH12
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    292148 (Eif3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    292148 (Eif3a)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    292148 (Eif3a)
SSDB
Motif
Pfam: PCI
Other DBs
NCBI-GeneID: 292148
NCBI-ProteinID: NP_001040552
RGD: 1307269
Ensembl: ENSRNOG00000010117
UniProt: Q1JU68
Position
1q55
AA seq 1354 aa
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYIKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRVK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERKITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGEDPLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRETRDDERPHRRDEDRLRRLGGDDEERESSLRPDDDRIPRR
GLDDDRGPRRGPDEDRFSRRGTDDDRPSWRNADDDRPPRRIGDDDRGSWRHTDDDRPPRR
GLDDDRPPRRGLDDERGSWRTAEEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPR
RGMDDDRGPRRGLDDDRGPWRNAAEDRISRRGADDDRGPWRNMDDDRVPRRGDDARPGPW
RPFVKPGGWREKEKAREESWGPPRESRPPEEREWDRDKEKDRDNQDREENDKDLERDRDR
ERDGDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRRDRDDRRDLRDLRDR
RDLRDDRDRRGPPLRSEREEASSWRRTDDRKDDRTEERDPPRRVPPPTLSRERERERDRE
GEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaatgccctcaagcgcgccaacgaatttcttgag
gttggcaaaaagcagcctgccctggatgttctttatgatgttatgaaaagtaagaaacac
agaacatggcagaagatacacgagccaattatgctgaaatacttggaactatgtgtggat
cttcgtaagagccacttggctaaggaaggattatatcaatataagaacatttgtcagcag
gtaaacattaaatctttagaagatgttgttagggcatatttgaaattagcagaggaaaaa
acagaagctgctaaagaagagtcccaacaaatggtgttagacatagaagatctggataat
attcagactcctgagagtgttctcttaagtgcagtaagtggggaagacactcaggatcgt
actgacagattgctactgactccctgggtcaagttcctgtgggaatcatacaggcagtgt
ttggaccttcttcgaaacaattctagagtagagcgtctttaccatgatatcgcccaacaa
gctttcaaattctgcctccagtatactcgcaaggctgagttccgcaagctgtgtgacaac
ttgcgaatgcacttatcccagattcagcgccaccataaccaaagtacagcaatcaatctt
aataatccagagagccagtccatgcatttggaaaccagacttgttcagctggacagtgct
atcagcatggaattgtggcaggaagccttcaaagctgtggaagatattcatggactattt
tccttgtctaaaaaaccacctaagcctcagttgatggcaaattactataacaaagtttca
acggtgttttggaaatctggaaatgctttgtttcatgcatctacacttcatcgtctttat
catctgtctagagaaatgagaaagaatcttacacaagatgagatgcaaagaatgtctact
agagtccttttggcgactctttccattcctattactcctgagcgaactgatattgcacga
cttttggatatggatggtattatagttgagaagcagcggcgccttgccacattgctaggt
cttcaagcaccacccacacgaattggacttattaatgatatggtcaggtttaatgtgcta
caatatgttgtcccagaagtgaaagacctttacaactggttggaggtggaattcaaccca
ctaaaactctgtgagagagttacaaaggtattaaattgggttagggaacaacctgaaaaa
gaaccagaattgcaacaatatgtgccacaactacagaacaataccatactccgtcttctg
caacaggtggcacagatttatcagagcattgagttttctcgtttgacctctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgcagctaggcactgtgacctg
caggttcgtattgaccatacttctcggactctgagttttggatcagacttaaattatgca
actcgagaagatgccccaattggtcctcatctgcagagcatgccttcagaacaaataaga
aatcaactgacagccatgtcctcggtacttgcaaaagcgcttgaagtcatcaagcctgct
catattctgcaagagaaagaagaacagcatcagttggcagttactgcgtatattaaaaat
tcacggaaagagcatcagaggatcctggctcggagacagacaattgaggagagaaaagag
cgtcttgagagtctgaatattcaacgtgagaaggaagaactagagcagagggaagctgaa
ctccagaaagtacggaaggctgaagaagaaaggctgcgtcaagaggcaaaggagcgagag
aaggaacggatccttcaagaacatgaacaaatcaagaagaaaactgttcgggagcggtta
gaacagatcaagaagacagagctgggtgccaaagcatttaaagatattgacattgaagac
cttgaagaattggatccagattttattatggccaaacaagttgaacaactagaaaaagaa
aagaaggaacttcaggaacgccttaagaatcaagaaaagaagattgactattttgagaga
gctaagcgtttggaagaaattcctttaataaagagtgcttacgaggaacaaagggttaaa
gacatggacctgtgggaacaacaagaagaagaaagaattactacaatgcagctagaacga
gaaaaagctctggaacataagaatcggatgtcacgaatgttggaagacagagatctattt
gtgatgcggctcaaagctgcccggcagtctgtctatgaggagaaactgaaacagtttgaa
gagcgtttagcagaagaaaggcataatcgcctggaagaacggaagaggcaacggaaagaa
gaacgcaaaataacttactacagagaaaaggaagaggaagagcagagaagggcagaggag
cagatgctcaaagagcgagaagaaagagaacgagctgagagagcaaaacgtgaggaagaa
cttagagaatatcaggagcgagtcaagaaactggaagaagtagaaaggaaaaagcggcaa
agagagctggaaattgaagaaagggaaagacgcagagaggaagaaaggagacttggtgag
gatccactttctaggaaggactctcgttggggagatagagattcagaaggcacctggaga
aaaggaccagaagctgactctgagtggagaagaggcccaccagaaaaggagtggagacga
gaaactcgggatgatgagaggcctcacaggagagatgaggatcggctgaggcgcttgggg
ggggacgatgaagagagagagtcgtctcttagaccagatgatgatcgcatccccaggcgt
ggcctggatgatgacagagggcctagacgtggtcccgatgaagatagattttctcgtaga
ggaacagatgatgaccgtccttcctggcgtaatgcagatgatgaccggcctcccaggcga
attggtgatgatgacaggggaagctggcgtcacacagatgatgacagaccacccagacgg
ggactggatgatgacagaccacccagacggggactggatgatgagagaggaagctggcgc
acagcagaagaggacagaggacctagacgtgggatggatgatgaccgggggccaagacga
ggaggtgctgatgatgagcggtcatcctggcggaatgctgatgacgataggggtcccagg
agggggatggatgacgataggggtcccaggcgagggttggatgatgatcgaggaccttgg
aggaatgctgctgaagataggatttccaggagaggtgcagatgatgaccgggggccttgg
agaaatatggatgacgatcgggttcctagacggggtgatgatgcaagacctggtccctgg
agaccatttgtcaaaccaggtggatggagagagaaagaaaaggctagagaagagagttgg
ggtccacctcgagaatcaagaccaccagaagaacgtgaatgggatagagacaaagagaag
gacagagataatcaagatcgagaggagaacgacaaggaccttgaacgtgatagggacaga
gagagagatggggaccgggaggatcgtttcagaagacccagggatgaaggtggctggaga
agaggaccagcagaagaatcttcaagctggagagattcaagtcgccgtgatgatagggac
agggatgaccgacggcgggacagagatgatcgtcgtgatctgagagacctgagagacaga
agggatttaagagatgatagagatcggagaggccctccccttagatcagagcgagaagaa
gcaagctcctggagacgcactgatgacaggaaagatgaccggactgaagaaagggatcca
cctcgtcgtgttcctcccccaactctttcaagagagagagaaagagagagagatcgagaa
ggtgagaaagagaaagcatcttggagagctgagaaagatagggagtcccttcgtcgtact
aagaatgaaactgatgaagatggatggaccacagtacgacgttaa

DBGET integrated database retrieval system