KEGG   Rattus norvegicus (rat): 29218Help
Entry
29218             CDS       T01003                                 

Gene name
Rcn2
Definition
(RefSeq) reticulocalbin 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 29218
NCBI-ProteinID: NP_058828
RGD: 3548
Ensembl: ENSRNOG00000015780
UniProt: Q62703
Position
8q24
AA seq 320 aa AA seqDB search
MRLGPRPAVLGLLLLLLLYAAVAGASKAEELHYPQGEHRADYDRETLLGVQEDVDEYVKL
GHEEQQRRLQSIIKKIDSDSDGFLTENELSQWIQMSFKHYAMQEAKQQFVEYDKNSDGTV
TWDEYNVQMYDRVIDFDENTALDDTEEESFRQLHLKDKKRFEKANQDSGPGLNLEEFIAF
EHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRRDPTANEDPEWILVEKDRFVN
DYDKDSDGRLDPQELLSWVVPNNQGIAQEEALHLIDEMDLNSDKKLSEEEILENQDLFLT
SEATDYGRQLHDDYFYHDEL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggcccaaggcccgcggtgctggggctgctgctgctgctgctgctgtacgcc
gcggtggccggcgccagcaaggcggaggagctgcattacccgcagggcgagcaccgggcg
gactacgaccgcgaaacgctgctaggtgtccaggaagacgtcgacgagtatgttaaactt
ggccacgaagagcagcaaagacgattgcagtcgatcataaagaaaattgactcggactct
gatggctttctcactgaaaatgaactcagtcagtggattcagatgtcgtttaagcattat
gccatgcaagaagccaagcagcagtttgtggagtatgacaagaacagcgacggcactgtg
acgtgggatgagtacaacgtccagatgtatgaccgcgtgattgactttgacgagaacact
gctctggatgacaccgaggaggagtcctttaggcagctccatctaaaggataagaagcga
tttgaaaaagctaaccaggattctggccctggtctgaatcttgaagagtttattgcattt
gaacacccagaagaagttgactatatgacggagttcgtcattcaggaggctttggaagag
catgacaaaaatggtgatgggtttgttagtctggaagaatttcttggcgattacaggcgg
gatccaactgcaaatgaagacccagaatggatacttgttgaaaaggacagatttgtgaat
gattatgacaaagacagcgatggccgccttgatccccaagagctgttgtcctgggtggtg
cccaataaccagggcattgcccaagaggaagctcttcatctgattgatgagatggatttg
aatagtgacaaaaagctctcggaagaagagattctggaaaaccaagacttgtttctcacc
agcgaagccacggattatggcagacagctccacgatgactatttctatcacgatgagctt
taa

DBGET integrated database retrieval system