KEGG   Rattus norvegicus (rat): 29219
Entry
29219             CDS       T01003                                 

Gene name
Snca
Definition
(RefSeq) alpha-synuclein
  KO
K04528  alpha-synuclein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29219 (Snca)
   05012 Parkinson disease
    29219 (Snca)
   05022 Pathways of neurodegeneration - multiple diseases
    29219 (Snca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29219 (Snca)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29219 (Snca)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    29219 (Snca)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   29219 (Snca)
SSDB
Motif
Pfam: Synuclein
Other DBs
NCBI-GeneID: 29219
NCBI-ProteinID: NP_062042
RGD: 3729
Ensembl: ENSRNOG00000008656
UniProt: P37377
Position
4
AA seq 140 aa
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP
SSEAYEMPSEEGYQDYEPEA
NT seq 423 nt   +upstreamnt  +downstreamnt
atggatgtgttcatgaaaggactttcaaaggccaaggagggagttgtggctgctgctgag
aaaaccaagcagggtgtggcagaggcagctgggaagacaaaagagggcgtcctctatgta
ggttccaaaactaaggagggagtcgttcatggagtgacaacagtggctgagaagaccaaa
gaacaagtgacaaatgttggaggggcagtggtgactggtgtgacagcagtcgctcagaag
acagtggagggagctgggaacattgctgctgccactggttttgtcaagaaggaccagatg
ggcaagggtgaagaagggtacccacaagagggaatcctggaagacatgcctgtggaccct
agcagtgaggcttatgaaatgccttcagaggaaggctaccaagactatgagcctgaagcc
taa

DBGET integrated database retrieval system