KEGG   Rattus norvegicus (rat): 292206Help
Entry
292206            CDS       T01003                                 

Gene name
Trip13
Definition
(RefSeq) thyroid hormone receptor interactor 13
  KO
K22399  pachytene checkpoint protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    292206 (Trip13)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Others
     292206 (Trip13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_22 AAA_16 AAA_18 AAA_14 AAA_33 AAA_25 Cytidylate_kin RuvB_N AAA_5 IstB_IS21 RNA_helicase TsaE AAA_30 AAA_28 TIP49 DUF815 AAA_11 NACHT AAA_7 AAA_24 Viral_helicase1 ABC_tran ATPase PduV-EutP AAA_2 Mg_chelatase AAA_17 PhoH Rad17 AAA_19 NB-ARC AAA_3 DUF2075
Motif
Other DBs
NCBI-GeneID: 292206
NCBI-ProteinID: NP_001011930
RGD: 1308516
Ensembl: ENSRNOG00000015810
UniProt: Q5XHZ9
Position
1p11
AA seq 432 aa AA seqDB search
MDDAVGDLKQALPCVAESPAVHVEVLQRSGSTAKKEDIKQSVYRLLKRHNIVFGDYVWTE
FDEPFLTRNVQSVSIVDTELKAKDPQPIDLSACTIALHIFQLNEEGPSSENLDEETENII
AASHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLLFSDKNVDSNLITWNRVVLLHGP
PGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLI
DDKEALVFVLIDEVESLTAARNACRAGAEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSN
ITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIG
FIENNVSKLSLLLSEISRKSEGLSGRVLRKLPFLAHALYIQAPSVTIEGFLQALSLAVDK
QFEEKKKLSAHV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgcggtgggcgacctgaagcaagcgcttccgtgtgttgccgagtcgcccgcg
gtccatgtggaggttttgcagcgcagcggaagcactgcaaaaaaagaagatataaagcag
agcgtttacaggctgctcaagaggcataacattgtgtttggagattacgtgtggactgag
tttgatgagccttttctaactagaaatgttcagtcggtatctattgttgacacagaatta
aaggctaaagaccctcagcccattgatctgagtgcatgcaccattgcacttcacatcttc
cagctgaatgaagaaggccccagcagtgaaaatttggatgaagaaacagaaaatataatt
gcagcaagtcactgggttttgcctgcagctgaatttcatgggctttgggatagcctcgtg
tatgatgtggaggtcaaatcacatctccttgactatgtgatgaccaccttactattctca
gacaagaatgtggacagcaaccttatcacctggaaccgggtggtactgctgcacggtcct
ccgggtactggaaagacatccctttgtaaggcattagcccagaaactgaccatcagactg
tcaagcaggtaccggtatggccagttaattgaaataaacagccacagcctattttctaag
tggttttcagaaagtggcaagttggtaactaagatgttccagaagattcaggacttgatt
gatgataaagaagctttggtgtttgttctgattgatgaggtggagagtcttacagctgct
cgaaatgcttgcagggcaggcgcagagccatcagatgctatccgtgtagtcaatgctgtg
ttgactcagattgatcagattaaaaggcattccaatgtggtgattctgaccacttccaac
atcactgagaagattgatgtggcctttgtggatagagctgacatcaaacaatatattggc
cccccctctgcagcagccatcttcaaaatctacctgtcttgtttagaagaactgatgaag
tgccagatcatatatccccgtcagcagctgttgacccttcgagagctggaaatgattggc
ttcattgaaaataatgtgtcgaagttgagcctccttttgagtgaaatttcaaggaagagt
gagggcctcagcggccgggtcttgaggaaacttcctttcctggctcatgcgctgtatatc
caggctcccagcgtcaccatcgagggtttcctccaggccctgtcactggcagtggacaaa
cagtttgaggagaaaaagaaactctcagctcatgtttga

DBGET integrated database retrieval system